From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001967000
  • symbol?: selX
  • description?: staphylococcal enterotoxin-like toxin X

      descriptions from strain specific annotations:

    • staphylococcal enterotoxin-like toxin X
    • enterotoxin
    • superantigen-like protein
    • putative enterotoxin
    • putative exotoxin
    • staphylococcal enterotoxin
    • putative staphylococcal enterotoxin
  • strand?: +
  • coordinates?: 2440531..2441142
  • synteny block?: BlockID0013200
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0369
    08BA02176:
    11819-97:
    MS7_0360
    71193:
    ECT-R 2:
    ECTR2_331
    ED133:
    SAOV_0394
    ED98:
    SAAV_0338
    HO 5096 0412:
    SAEMRSA15_03240
    JH1:
    SaurJH1_0429
    JH9:
    SaurJH9_0419
    JKD6008:
    SAA6008_00370
    JKD6159:
    SAA6159_00344
    LGA251:
    SARLGA251_03320
    M013:
    M013TW_0349
    MRSA252:
    MSHR1132:
    SAMSHR1132_03430
    MSSA476:
    SAS0347
    Mu3:
    SAHV_0367
    Mu50:
    SAV0370
    MW2:
    MW0345
    RF122:
    SAB0321
    ST398:
    T0131:
    SAT0131_00402
    TCH60:
    TW20:
    SATW20_04380
    USA300_TCH1516:
    USA300HOU_0392
    VC40:
    SAVC_01605

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFKKYDSKNSIVLKSILSLGIIYGGTFGIYPKADASTQNSSSVQDKQLQKVEEVPNNSEK
    N315            MFKKYDSKNSIVLKSILSLGIIYGGTFGIYPKADASTQNSSSVQDKQLQKVEEVPNNSEK
    NCTC8325        MFKKYDSKNSIVLKSILSLGIIYGGTFGIYPKADASTQNSSSVQDKQLQKVEEVPNNSEK
    Newman          MFKKYDSKNSIVLKSILSLGIIYGGTFGIYPKADASTQNSSSVQDKQLQKVEEVPNNSEK
    USA300_FPR3757  MFKKYDSKNSIVLKSILSLGIIYGGTFGIYPKADASTQNSSSVQDKQLQKVEEVPNNSEK
                    ************************************************************

    COL             ALVKKLYDRYSKDTINGKSNKSRNWVYSERPLNENQVRIHLEGTYTVAGRVYTPKRNITL
    N315            ALVKKLYDRYSKDTINGKSNKSRNWVYSERPLNENQVRIHLEGTYTVADRVYTPKRNITL
    NCTC8325        ALVKKLYDRYSKDTINGKSNKSRNWVYSERPLNENQVRIHLEGTYTVAGRVYTPKRNITL
    Newman          ALVKKLYDRYSKDTINGKSNKSRNWVYSERPLNENQVRIHLEGTYTVAGRVYTPKRNITL
    USA300_FPR3757  ALVKKLYDRYSKDTINGKSNKSRNWVYSERPLNENQVRIHLEGTYTVAGRVYTPKRNITL
                    ************************************************.***********

    COL             NKEVVTLKELDHIIRFAHISYGLYMGEHLPKGNIVINTKDGGKYTLESHKELQKDRENVK
    N315            NKEVVTLKELDHIIRFAHISYGLYMGEHLPKGNIVINTKDGGKYTLESHKELQKDRENVK
    NCTC8325        NKEVVTLKELDHIIRFAHISYGLYMGEHLPKGNIVINTKDGGKYTLESHKELQKDRENVK
    Newman          NKEVVTLKELDHIIRFAHISYGLYMGEHLPKGNIVINTKDGGKYTLESHKELQKDRENVK
    USA300_FPR3757  NKEVVTLKELDHIIRFAHISYGLYMGEHLPKGNIVINTKDGGKYTLESHKELQKDRENVK
                    ************************************************************

    COL             INTADIKNVTFKLVKSVNDIEQV
    N315            INTADIKNVTFKLVKSVNDIEQV
    NCTC8325        INTADIKNVTFKLVKSVNDIEQV
    Newman          INTADIKNVTFKLVKSVNDIEQV
    USA300_FPR3757  INTADIKNVTFKLVKSVNDIEQV
                    ***********************