From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001972000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 2442776..2443039
  • synteny block?: BlockID0013250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0372
    08BA02176:
    C248_0429
    11819-97:
    MS7_0364
    71193:
    ST398NM01_0451
    ECT-R 2:
    ECTR2_334
    ED133:
    SAOV_0397c
    ED98:
    SAAV_0341
    HO 5096 0412:
    SAEMRSA15_03270
    JH1:
    SaurJH1_0432
    JH9:
    SaurJH9_0422
    JKD6008:
    SAA6008_00374
    JKD6159:
    SAA6159_00347
    LGA251:
    SARLGA251_03350
    M013:
    M013TW_0353
    MRSA252:
    SAR0391
    MSHR1132:
    SAMSHR1132_03460
    MSSA476:
    SAS0350
    Mu3:
    SAHV_0370
    Mu50:
    SAV0373
    MW2:
    MW0348
    RF122:
    SAB0324c
    ST398:
    SAPIG0451
    T0131:
    SAT0131_00406
    TCH60:
    HMPREF0772_10121
    TW20:
    SATW20_04410
    USA300_TCH1516:
    USA300HOU_0396
    VC40:
    SAVC_01620

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNMHILYNLRTKHNLEIDELAQQLNEKYGTKYEAHQIWEWENHHHEPKFKDAMHLADFFD
    N315            MNMHILYNLRTKHNLEIDELAQQLNEKYGTKYEAHQIWEWENHHHEPKFKDAMHLADFFD
    NCTC8325        MNMHILYNLRTKHNLEIDELAQQLNEKYGTKYEAHQIWEWENHHHEPKFKDAMHLADFFD
    Newman          MNMHILYNLRTKHNLEIDELAQQLNEKYGTKYEAHQIWEWENHHHEPKFKDAMHLADFFD
    USA300_FPR3757  MNMHILYNLRTKHNLEIDELAQQLNEKYGTKYEAHQIWEWENHHHEPKFKDAMHLADFFD
                    ************************************************************

    COL             APYEMFLESKVKEYQKHLEEVDIRMDK
    N315            APYEMFLESKVKEYQKHLEEVDIRMDK
    NCTC8325        APYEMFLESKVKEYQKHLEEVDIRMDK
    Newman          APYEMFLESKVKEYQKHLEEVDIRMDK
    USA300_FPR3757  APYEMFLESKVKEYQKHLEEVDIRMDK
                    ***************************