From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001979000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 2446315..2446506
  • synteny block?: BlockID0013320
  • occurrence?: in 66% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0378
    08BA02176:
    11819-97:
    MS7_0369
    71193:
    ECT-R 2:
    ECTR2_339
    ED133:
    SAOV_0402c
    ED98:
    SAAV_0346
    HO 5096 0412:
    JH1:
    SaurJH1_0438
    JH9:
    SaurJH9_0427
    JKD6008:
    SAA6008_00379
    JKD6159:
    LGA251:
    SARLGA251_03400
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0376
    Mu50:
    SAV0379
    MW2:
    RF122:
    SAB0329c
    ST398:
    T0131:
    SAT0131_00412
    TCH60:
    TW20:
    SATW20_04460
    USA300_TCH1516:
    USA300HOU_0402
    VC40:
    SAVC_01650

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINLIYTTRCAIMLKVCTSRKQINMKNDIEKEKYVNEIIMLLRTIPTSKLVQPIMQLFID
    N315            ----------------------------------MNEIIMLLRTIPTSKLIQPIMQLFID
    NCTC8325        MINLIYTTRCAIMLKVCTSRKQINMKNDIEKEKYVNEIIMLLRTIPTSKLVQPIMQLFID
    Newman          MINLIYTTRCAIMLKVCTSRKQINMKNDIEKEKYVNEIIMLLRTIPTSKLVQPIMQLFID
    USA300_FPR3757  MINLIYTTRCAIMLKVCTSRKQINMKNDIEKEKYVNEIIMLLRTIPTSKLVQPIMQLFID
                                                      :***************:*********

    COL             KAILNNVQNDALLIEKATHARNHLRLWSLQGHRDIPN
    N315            NAILNIVQNDALLIEKATHARNHLRLWSLQGHRDIPN
    NCTC8325        KAILNNVQNDALLIEKATHARNHLRLWSLQGHRDIPN
    Newman          KAILNNVQNDALLIEKATHARNHLRLWSLQGHRDIPN
    USA300_FPR3757  KAILNNVQNDALLIEKATHARNHLRLWSLQGHRDIPN
                    :**** *******************************