From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001981000
  • symbol?: ahpF
  • description?: alkyl hydroperoxide reductase

      descriptions from strain specific annotations:

    • alkyl hydroperoxide reductase
    • alkyl hydroperoxide reductase subunit F
    • Alkyl hydroperoxide reductase protein F
    • alkyl hydroperoxide reductase, F subunit
    • NADH oxidase H2O2-forming
    • alkyl hydroperoxide reductase, large subunit
  • strand?: -
  • coordinates?: 2448065..2449588
  • synteny block?: BlockID0013340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0451 (ahpF)
    N315:
    SA0365 (ahpF)
    NCTC8325:
    Newman:
    NWMN_0371 (ahpF)
    USA300_FPR3757:
    04-02981:
    SA2981_0379 (ahpF)
    08BA02176:
    C248_0436 (ahpF)
    11819-97:
    MS7_0370 (ahpF)
    71193:
    ST398NM01_0457
    ECT-R 2:
    ECTR2_340 (ahpF)
    ED133:
    SAOV_0403c (ahpF)
    ED98:
    SAAV_0347 (ahpF)
    HO 5096 0412:
    SAEMRSA15_03330 (ahpF)
    JH1:
    SaurJH1_0439
    JH9:
    SaurJH9_0428
    JKD6008:
    SAA6008_00380 (ahpF)
    JKD6159:
    SAA6159_00355 (ahpF)
    LGA251:
    SARLGA251_03410 (ahpF)
    M013:
    M013TW_0360
    MRSA252:
    SAR0398 (ahpF)
    MSHR1132:
    SAMSHR1132_03520
    MSSA476:
    SAS0357
    Mu3:
    SAHV_0377 (ahpF)
    Mu50:
    SAV0380 (ahpF)
    MW2:
    MW0356 (ahpF)
    RF122:
    SAB0330c (ahpF)
    ST398:
    SAPIG0457 (ahpF)
    T0131:
    SAT0131_00413
    TCH60:
    HMPREF0772_10115 (ahpF)
    TW20:
    SATW20_04470 (ahpF)
    USA300_TCH1516:
    USA300HOU_0403 (ahpF)
    VC40:
    SAVC_01655

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLNADLKQQLKQLLELMEGNVEFVASLGSDDKSKELKDLLTEITDMSPRLSLSEKSLKRT
    N315            MLNADLKQQLKQLLELMEGNVEFVASLGSDEKSKELKELLTEISDMSPRLSLSEKSLKRT
    NCTC8325        MLNADLKQQLKQLLELMEGNVEFVASLGSDDKSKELKDLLTEITDMSPRLSLSEKSLKRT
    Newman          MLNADLKQQLKQLLELMEGNVEFVASLGSDDKSKELKDLLTEITDMSPRLSLSEKSLKRT
    USA300_FPR3757  MLNADLKQQLKQLLELMEGNVEFVASLGSDDKSKELKDLLTEITDMSPRLSLSEKSLKRT
                    ******************************:******:*****:****************

    COL             PSFSVNRPGEETGVTFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKKLEGSFHFE
    N315            PSFSVNRPGEETGVTFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKNLEGSFHFE
    NCTC8325        PSFSVNRPGEETGVTFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKKLEGSFHFE
    Newman          PSFSVNRPGEETGVTFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKKLEGSFHFE
    USA300_FPR3757  PSFSVNRPGEETGVTFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIGQIKKLEGSFHFE
                    ***********************************************.***:********

    COL             TFISLTCQKCPDVVQALNLMSVINPNITHSMIDGAVFREESENIMAVPAVFLNGEEFGNG
    N315            TFISLTCQKCPDVVQALNLMSVINPNITHSMIDGAVFREESENIMAVPAVFLNGEEFGNG
    NCTC8325        TFISLTCQKCPDVVQALNLMSVINPNITHSMIDGAVFREESENIMAVPAVFLNGEEFGNG
    Newman          TFISLTCQKCPDVVQALNLMSVINPNITHSMIDGAVFREESENIMAVPAVFLNGEEFGNG
    USA300_FPR3757  TFISLTCQKCPDVVQALNLMSVINPNITHSMIDGAVFREESENIMAVPAVFLNGEEFGNG
                    ************************************************************

    COL             RMTIQDILSKLGSTADASEFENKEPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
    N315            RMTIQDILSKLGSTADASEFENKEPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
    NCTC8325        RMTIQDILSKLGSTADASEFENKEPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
    Newman          RMTIQDILSKLGSTADASEFENKEPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
    USA300_FPR3757  RMTIQDILSKLGSTADASEFENKEPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
                    ************************************************************

    COL             QVNDTAGIENFITVKETTGSEFSSNLAAHIDQYDIDAMTGIRATDIEKTDEAIKVTLENG
    N315            QVNDTAGIENFITVKETTGSEFSSNLAAHIDQYDIDAMTGIRATDIEKTDEAIKVTLENG
    NCTC8325        QVNDTAGIENFITVKETTGSEFSSNLAAHIDQYDIDAMTGIRATDIEKTDEAIKVTLENG
    Newman          QVNDTAGIENFITVKETTGSEFSSNLAAHIDQYDIDAMTGIRATDIEKTDEAIKVTLENG
    USA300_FPR3757  QVNDTAGIENFITVKETTGSEFSSNLAAHIDQYDIDAMTGIRATDIEKTDEAIKVTLENG
                    ************************************************************

    COL             AVLESKTVIIATGAGWRKLNIPGEEQLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
    N315            AVLESKTVIIATGAGWRKLNIPGEEQLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
    NCTC8325        AVLESKTVIIATGAGWRKLNIPGEEQLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
    Newman          AVLESKTVIIATGAGWRKLNIPGEEQLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
    USA300_FPR3757  AVLESKTVIIATGAGWRKLNIPGEEQLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
                    ************************************************************

    COL             AIDLAGIVNHVTLFEFASELKADNVLQDRLRSLSNVDIKTNAKTTEVVGEDHVTGIRYED
    N315            AIDLAGIVNHVTLFEFASELKADNVLQDRLRSLSNVDIKTNAKTTEVVGEDHVTGIRYED
    NCTC8325        AIDLAGIVNHVTLFEFASELKADNVLQDRLRSLSNVDIKTNAKTTEVVGEDHVTGIRYED
    Newman          AIDLAGIVNHVTLFEFASELKADNVLQDRLRSLSNVDIKTNAKTTEVVGEDHVTGIRYED
    USA300_FPR3757  AIDLAGIVNHVTLFEFASELKADNVLQDRLRSLSNVDIKTNAKTTEVVGEDHVTGIRYED
                    ************************************************************

    COL             MNTGEEHLLNLDGIFVQIGLLPNTSWLNDAVELNERGEIVIDRNNNTNVPGIFAAGDVTD
    N315            MSTGEEHLLNLDGIFVQIGLLPNTSWLKDAVELNERGEIVIDRNNNTNVPGIFAAGDVTD
    NCTC8325        MNTGEEHLLNLDGIFVQIGLLPNTSWLNDAVELNERGEIVIDRNNNTNVPGIFAAGDVTD
    Newman          MNTGEEHLLNLDGIFVQIGLLPNTSWLNDAVELNERGEIVIDRNNNTNVPGIFAAGDVTD
    USA300_FPR3757  MNTGEEHLLNLDGIFVQIGLLPNTSWLNDAVELNERGEIVIDRNNNTNVPGIFAAGDVTD
                    *.*************************:********************************

    COL             QKNKQIIISMGAGANAALNAFDYIIRN
    N315            QKNKQIIISMGAGANAALNAFDYIIRN
    NCTC8325        QKNKQIIISMGAGANAALNAFDYIIRN
    Newman          QKNKQIIISMGAGANAALNAFDYIIRN
    USA300_FPR3757  QKNKQIIISMGAGANAALNAFDYIIRN
                    ***************************