Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001982000
  • symbol?: ahpC
  • description?: alkyl hydroperoxide reductase

      descriptions from strain specific annotations:

    • alkyl hydroperoxide reductase
    • alkyl hydroperoxide reductase subunit C
    • Alkyl hydroperoxide reductase protein C
    • peroxiredoxin
  • strand?: -
  • coordinates?: 2449604..2450173
  • synteny block?: BlockID0013350
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0452 (ahpC)
    N315:
    SA0366 (ahpC)
    NCTC8325:
    Newman:
    NWMN_0372 (ahpC)
    USA300_FPR3757:
    04-02981:
    SA2981_0380 (ahpC)
    08BA02176:
    C248_0437 (ahpC)
    11819-97:
    MS7_0371 (ahpC)
    71193:
    ST398NM01_0458
    ECT-R 2:
    ECTR2_341 (ahpC)
    ED133:
    SAOV_0404c (ahpC)
    ED98:
    SAAV_0348 (ahpC)
    HO 5096 0412:
    SAEMRSA15_03340 (ahpC)
    JH1:
    SaurJH1_0440
    JH9:
    SaurJH9_0429
    JKD6008:
    SAA6008_00381 (ahpC)
    JKD6159:
    SAA6159_00356 (ahpC)
    LGA251:
    SARLGA251_03420 (ahpC)
    M013:
    M013TW_0361
    MRSA252:
    SAR0399 (ahpC)
    MSHR1132:
    SAMSHR1132_03530
    MSSA476:
    SAS0358
    Mu3:
    SAHV_0378 (ahpC)
    Mu50:
    SAV0381 (ahpC)
    MW2:
    MW0357 (ahpC)
    RF122:
    SAB0331c (ahpC)
    ST398:
    SAPIG0458 (ahpC)
    T0131:
    SAT0131_00414 (adhE)
    TCH60:
    HMPREF0772_10114 (ahpC)
    TW20:
    SATW20_04480 (ahpC)
    USA300_TCH1516:
    USA300HOU_0404 (ahpC1)
    VC40:
    SAVC_01660

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSLINKEILPFTAQAFDPKKDQFKEVTQEDLKGSWSVVCFYPADFSFVCPTELEDLQNQY
    N315            MSLINKEILPFTAQAFDPKKDQFKEVTQEDLKGSWSVVCFYPADFSFVCPTELEDLQNQY
    NCTC8325        MSLINKEILPFTAQAFDPKKDQFKEVTQEDLKGSWSVVCFYPADFSFVCPTELEDLQNQY
    Newman          MSLINKEILPFTAQAFDPKKDQFKEVTQEDLKGSWSVVCFYPADFSFVCPTELEDLQNQY
    USA300_FPR3757  MSLINKEILPFTAQAFDPKKDQFKEVTQEDLKGSWSVVCFYPADFSFVCPTELEDLQNQY
                    ************************************************************

    COL             EELQKLGVNVFSVSTDTHFVHKAWHDHSDAISKITYTMIGDPSQTITRNFDVLDEATGLA
    N315            EELQKLGVNVFSVSTDTHFVHKAWHDHSDAISKITYTMIGDPSQTITRNFDVLDEATGLA
    NCTC8325        EELQKLGVNVFSVSTDTHFVHKAWHDHSDAISKITYTMIGDPSQTITRNFDVLDEATGLA
    Newman          EELQKLGVNVFSVSTDTHFVHKAWHDHSDAISKITYTMIGDPSQTITRNFDVLDEATGLA
    USA300_FPR3757  EELQKLGVNVFSVSTDTHFVHKAWHDHSDAISKITYTMIGDPSQTITRNFDVLDEATGLA
                    ************************************************************

    COL             QRGTFIIDPDGVVQASEINADGIGRDASTLAHKIKAAQYVRKNPGEVCPAKWEEGAKTLQ
    N315            QRGTFIIDPDGVVQASEINADGIGRDASTLAHKIKAAQYVRKNPGEVCPAKWEEGAKTLQ
    NCTC8325        QRGTFIIDPDGVVQASEINADGIGRDASTLAHKIKAAQYVRKNPGEVCPAKWEEGAKTLQ
    Newman          QRGTFIIDPDGVVQASEINADGIGRDASTLAHKIKAAQYVRKNPGEVCPAKWEEGAKTLQ
    USA300_FPR3757  QRGTFIIDPDGVVQASEINADGIGRDASTLAHKIKAAQYVRKNPGEVCPAKWEEGAKTLQ
                    ************************************************************

    COL             PGLDLVGKI
    N315            PGLDLVGKI
    NCTC8325        PGLDLVGKI
    Newman          PGLDLVGKI
    USA300_FPR3757  PGLDLVGKI
                    *********