From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001985000
  • symbol?: tcyP
  • description?: L-cystine transporter

      descriptions from strain specific annotations:

    • L-cystine transporter
    • sodium:dicarboxylate symporter family protein
    • L-cystine uptake protein tcyP
    • proton/sodium-glutamate symport protein
    • DAACS family dicarboxylate/amino acid:sodium or proton symporter
    • hypothetical symporter YdjN
    • putative sodium:dicarboxylate symporter protein
    • sodium/dicarboxylare symporter
    • sodium:dicarboxylate symporter
    • sodium:dicarboxylate symporter protein
    • symporter ydjN
  • strand?: -
  • coordinates?: 2451511..2452899
  • synteny block?: BlockID0013380
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0382
    08BA02176:
    C248_0439
    11819-97:
    MS7_0373 (tcyP)
    71193:
    ST398NM01_0461
    ECT-R 2:
    ECTR2_343
    ED133:
    SAOV_0406c
    ED98:
    SAAV_0350
    HO 5096 0412:
    SAEMRSA15_03360
    JH1:
    SaurJH1_0442
    JH9:
    SaurJH9_0431
    JKD6008:
    SAA6008_00383
    JKD6159:
    SAA6159_00358
    LGA251:
    SARLGA251_03440
    M013:
    M013TW_0363
    MRSA252:
    SAR0401
    MSHR1132:
    SAMSHR1132_03550
    MSSA476:
    SAS0360
    Mu3:
    SAHV_0380
    Mu50:
    SAV0383
    MW2:
    MW0359
    RF122:
    SAB0333c
    ST398:
    SAPIG0461
    T0131:
    SAT0131_00416 (capA)
    TCH60:
    HMPREF0772_10112
    TW20:
    SATW20_04500
    USA300_TCH1516:
    USA300HOU_0406
    VC40:
    SAVC_01670

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNAFLTLINIIVLVIFIVILHMMARKHISFAKRVFTALGIGIVFGVLLHLIYGTHSNVIT
    N315            MNAFLTLINIIVLVIFIVILHMMARKHISFAKRVFTALGIGIVFGVLLHLVYGTHSNVIT
    NCTC8325        MNAFLTLINIIVLVIFIVILHMMARKHISFAKRVFTALGIGIVFGVLLHLIYGTHSNVIT
    Newman          MNAFLTLINIIVLVIFIVILHMMARKHISFAKRVFTALGIGIVFGVLLHLIYGTHSNVIT
    USA300_FPR3757  MNAFLTLINIIVLVIFIVILHMMARKHISFAKRVFTALGIGIVFGVLLHLIYGTHSNVIT
                    **************************************************:*********

    COL             STSDWFNIVGQGYVALLQMIVMPLIFISIVAAFTKIQIGEKFAKIGSLIFIFLIGTVTIA
    N315            STSDWFNIVGQGYVALLQMIVMPLIFISIVAAFTKIQIGEKFAKIGSLIFIFLIGTVTIA
    NCTC8325        STSDWFNIVGQGYVALLQMIVMPLIFISIVAAFTKIQIGEKFAKIGSLIFIFLIGTVTIA
    Newman          STSDWFNIVGQGYVALLQMIVMPLIFISIVAAFTKIQIGEKFAKIGSLIFIFLIGTVTIA
    USA300_FPR3757  STSDWFNIVGQGYVALLQMIVMPLIFISIVAAFTKIQIGEKFAKIGSLIFIFLIGTVTIA
                    ************************************************************

    COL             AIVGVVYALVFGLDASTINLGNAEQARGSEIAKQAKDLTAHTLPQQILELLPKNPFLDFT
    N315            AIVGVVYALVFGLDASTINLGNAEQARGSEIAKQAKDLTAHTLPQQILELLPKNPFLDFT
    NCTC8325        AIVGVVYALVFGLDASTINLGNAEQARGSEIAKQAKDLTAHTLPQQILELLPKNPFLDFT
    Newman          AIVGVVYALVFGLDASTINLGNAEQARGSEIAKQAKDLTAHTLPQQILELLPKNPFLDFT
    USA300_FPR3757  AIVGVVYALVFGLDASTINLGNAEQARGSEIAKQAKDLTAHTLPQQILELLPKNPFLDFT
                    ************************************************************

    COL             GQRATSTIAVVIFASFIGFAYLRVARKQPDHGELLKRAIDAIYSLVMAIVTFVLRLTPYG
    N315            GQRATSTIAVVIFASFIGFAYLRVARKQPDHGELLKRAIDAIYSLVMAIVTFVLRLTPYG
    NCTC8325        GQRATSTIAVVIFASFIGFAYLRVARKQPDHGELLKRAIDAIYSLVMAIVTFVLRLTPYG
    Newman          GQRATSTIAVVIFASFIGFAYLRVARKQPDHGELLKRAIDAIYSLVMAIVTFVLRLTPYG
    USA300_FPR3757  GQRATSTIAVVIFASFIGFAYLRVARKQPDHGELLKRAIDAIYSLVMAIVTFVLRLTPYG
                    ************************************************************

    COL             VLAIMANTLSTSDFGAIWTLGKFLIASYAALITMYIIHLIILSLLGISPIRYVKKTLEVL
    N315            VLAIMANTLSTSDFGAIWTLGKFLIASYAALITMYIIHLIILSLLGISPIRYVKKTLEVL
    NCTC8325        VLAIMANTLSTSDFGAIWTLGKFLIASYAALITMYIIHLIILSLLGISPIRYVKKTLEVL
    Newman          VLAIMANTLSTSDFGAIWTLGKFLIASYAALITMYIIHLIILSLLGISPIRYVKKTLEVL
    USA300_FPR3757  VLAIMANTLSTSDFGAIWTLGKFLIASYAALITMYIIHLIILSLLGISPIRYVKKTLEVL
                    ************************************************************

    COL             IFAFTSRSSAGALPLNVQTQTRRLGVPEGIANFAATFGLSIGQNGCAGIYPAMLAIMVAP
    N315            IFAFTSRSSAGALPLNVQTQTRRLGVPEGIANFAATFGLSIGQNGCAGIYPAMLAIMVAP
    NCTC8325        IFAFTSRSSAGALPLNVQTQTRRLGVPEGIANFAATFGLSIGQNGCAGIYPAMLAIMVAP
    Newman          IFAFTSRSSAGALPLNVQTQTRRLGVPEGIANFAATFGLSIGQNGCAGIYPAMLAIMVAP
    USA300_FPR3757  IFAFTSRSSAGALPLNVQTQTRRLGVPEGIANFAATFGLSIGQNGCAGIYPAMLAIMVAP
                    ************************************************************

    COL             VANVEIDLQFIVTLIAVVIISSFGVAGVGGGATFASILVLSTLNLPVALAGVLISVEPLI
    N315            VANVEIDLQFIVTLIAVVIISSFGVAGVGGGATFASILVLSTLNLPVALAGVLISVEPLI
    NCTC8325        VANVEIDLQFIVTLIAVVIISSFGVAGVGGGATFASILVLSTLNLPVALAGVLISVEPLI
    Newman          VANVEIDLQFIVTLIAVVIISSFGVAGVGGGATFASILVLSTLNLPVALAGVLISVEPLI
    USA300_FPR3757  VANVEIDLQFIVTLIAVVIISSFGVAGVGGGATFASILVLSTLNLPVALAGVLISVEPLI
                    ************************************************************

    COL             DMGRTALNVNDSMLAGTGTAKLTKHWDKDTFDSNDNAALTSH
    N315            DMGRTALNVNDSMLAGTGTAKLTKHWDKDTFESNDNAALTSH
    NCTC8325        DMGRTALNVNDSMLAGTGTAKLTKHWDKDTFDSNDNAALTSH
    Newman          DMGRTALNVNDSMLAGTGTAKLTKHWDKDTFDSNDNAALTSH
    USA300_FPR3757  DMGRTALNVNDSMLAGTGTAKLTKHWDKDTFDSNDNAALTSH
                    *******************************:**********