From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001992000
  • symbol?:
  • description?: putative heat induced stress protein

      descriptions from strain specific annotations:

    • putative heat induced stress protein
    • transcriptional regulator
  • strand?: -
  • coordinates?: 2457793..2458200
  • synteny block?: BlockID0013450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0385
    08BA02176:
    C248_0443
    11819-97:
    MS7_0376
    71193:
    ST398NM01_0464
    ECT-R 2:
    ECTR2_346
    ED133:
    SAOV_0409c
    ED98:
    SAAV_0353
    HO 5096 0412:
    SAEMRSA15_03390
    JH1:
    SaurJH1_0445
    JH9:
    SaurJH9_0434
    JKD6008:
    SAA6008_00386 (yflT)
    JKD6159:
    SAA6159_00361 (yflT)
    LGA251:
    SARLGA251_03470
    M013:
    M013TW_0366
    MRSA252:
    SAR0405
    MSHR1132:
    SAMSHR1132_03580
    MSSA476:
    SAS0363
    Mu3:
    SAHV_0384
    Mu50:
    SAV0387
    MW2:
    MW0363
    RF122:
    SAB0337c
    ST398:
    SAPIG0464
    T0131:
    SAT0131_00419 (capD)
    TCH60:
    HMPREF0772_10107
    TW20:
    SATW20_04530
    USA300_TCH1516:
    USA300HOU_0410
    VC40:
    SAVC_01685

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MADITVVNDTGELYNVINQKKSEGYLESELTIISKSKLHLNDLHDSEISLISTSGTFSDR
    N315            MADITVVNDTGELYNVINQKKSEGYLESELTIISKSKLHLNDLHDSEISLISTSGTFSDR
    NCTC8325        MADITVVNDTGELYNVINQKKSEGYLESELTIISKSKLHLNDLHDSEISLISTSGTFSDR
    Newman          MADITVVNDTGELYNVINQKKSEGYLESELTIISKSKLHLNDLHDSEISLISTSGTFSDR
    USA300_FPR3757  MADITVVNDTGELYNVINQKKSEGYLESELTIISKSKLHLNDLHDSEISLISTSGTFSDR
                    ************************************************************

    COL             MTKLLTGEDGEHAVLSRYNLAPDELEKYKQLILDDKMLVVAVRDKSSHQEVHENNSAYEE
    N315            MTKLLTGEDGEHAVLSRYNLAPDELEKYKQLILDDKMLVVAVRDKSSHKEVQEHNSAYEE
    NCTC8325        MTKLLTGEDGEHAVLSRYNLAPDELEKYKQLILDDKMLVVAVRDKSSHQEVHENNSAYEE
    Newman          MTKLLTGEDGEHAVLSRYNLAPDELEKYKQLILDDKMLVVAVRDKSSHQEVHENNSAYEE
    USA300_FPR3757  MTKLLTGEDGEHAVLSRYNLAPDELEKYKQLILDDKMLVVAVRDKSSHQEVHENNSAYEE
                    ************************************************:**:*:******

    COL             IDITHFAEASKGPKA
    N315            IDITHFAEASKGPKA
    NCTC8325        IDITHFAEASKGPKA
    Newman          IDITHFAEASKGPKA
    USA300_FPR3757  IDITHFAEASKGPKA
                    ***************