From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001995000
  • symbol?: pbuX
  • description?: xanthine permease

      descriptions from strain specific annotations:

    • xanthine permease
    • uracil-xanthine permease
    • xanthine permease family protein
    • putative xanthine permease
    • xanthine/uracil permease
    • NCS2 family nucleobase:cation symporter-2
    • NCS2 nucleobase cation symporter, PbuX
  • strand?: +
  • coordinates?: 2459294..2460562
  • synteny block?: BlockID0013480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0459 (pbuX)
    N315:
    SA0374 (pbuX)
    NCTC8325:
    Newman:
    NWMN_0379 (pbuX)
    USA300_FPR3757:
    04-02981:
    SA2981_0387 (pbuX)
    08BA02176:
    C248_0445 (pbuX)
    11819-97:
    MS7_0378 (pbuX)
    71193:
    ST398NM01_0466
    ECT-R 2:
    ECTR2_348 (pbuX)
    ED133:
    SAOV_0411 (pbuX)
    ED98:
    SAAV_0356 (pbuX)
    HO 5096 0412:
    SAEMRSA15_03410 (pbuX)
    JH1:
    SaurJH1_0447
    JH9:
    SaurJH9_0436
    JKD6008:
    SAA6008_00388 (pbuX)
    JKD6159:
    SAA6159_00363 (pbuX)
    LGA251:
    SARLGA251_03490 (pbuX)
    M013:
    M013TW_0368
    MRSA252:
    SAR0407 (pbuX)
    MSHR1132:
    SAMSHR1132_03600
    MSSA476:
    SAS0365
    Mu3:
    SAHV_0386 (pbuX)
    Mu50:
    SAV0389 (pbuX)
    MW2:
    MW0365 (pbuX)
    RF122:
    SAB0339 (pbuX)
    ST398:
    SAPIG0466
    T0131:
    SAT0131_00421
    TCH60:
    HMPREF0772_10105 (pbuX)
    TW20:
    SATW20_04550 (pbuX)
    USA300_TCH1516:
    USA300HOU_0412 (pbuX)
    VC40:
    SAVC_01695

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNLILSVQHLLAMYAGAILVPIIVGTSLKFTPEQIAYLVTVDIFMCGVATFLQANKVTG
    N315            MKNLILSVQHLLAMYAGAILVPIIVGTSLKFTPEQIAYLVTVDIFMCGVATFLQANKVTG
    NCTC8325        MKNLILSVQHLLAMYAGAILVPIIVGTSLKFTPEQIAYLVTVDIFMCGVATFLQANKVTG
    Newman          MKNLILSVQHLLAMYAGAILVPIIVGTSLKFTPEQIAYLVTVDIFMCGVATFLQANKVTG
    USA300_FPR3757  MKNLILSVQHLLAMYAGAILVPIIVGTSLKFTPEQIAYLVTVDIFMCGVATFLQANKVTG
                    ************************************************************

    COL             TGLPIVLGCTFTAVAPMILIGQTKGIDVLYGSLFLSGILVIIIAPFFSHLVKFFPPVVTG
    N315            TGLPIVLGCTFTAVAPMILIGQTKGIDVLYGSLFLSGILVIIIAPFFSHLVKFFPPVVTG
    NCTC8325        TGLPIVLGCTFTAVAPMILIGQTKGIDVLYGSLFLSGILVIIIAPFFSHLVKFFPPVVTG
    Newman          TGLPIVLGCTFTAVAPMILIGQTKGIDVLYGSLFLSGILVIIIAPFFSHLVKFFPPVVTG
    USA300_FPR3757  TGLPIVLGCTFTAVAPMILIGQTKGIDVLYGSLFLSGILVIIIAPFFSHLVKFFPPVVTG
                    ************************************************************

    COL             SVVTIIGINLMPVAMNYLAGGQGAKDYGDVKNILLGLMTLIIILLLQRFTTGFIKSIAIL
    N315            SVVTIIGINLMPVAMNYLAGGQGAKDYGDVKNILLGLMTLIIILVLQRFTTGFIKSIAIL
    NCTC8325        SVVTIIGINLMPVAMNYLAGGQGAKDYGDVKNILLGLMTLIIILLLQRFTTGFIKSIAIL
    Newman          SVVTIIGINLMPVAMNYLAGGQGAKDYGDVKNILLGLMTLIIILLLQRFTTGFIKSIAIL
    USA300_FPR3757  SVVTIIGINLMPVAMNYLAGGQGAKDYGDVKNILLGLMTLIIILLLQRFTTGFIKSIAIL
                    ********************************************:***************

    COL             IGLVLGTIGAGLLGMVDINQVNHAGWLGIPVPFRFSGFSFDVTSTLVFFIVAIVSLIEST
    N315            IGLVLGTIGAGLLGMVDINQVNHAGWLGIPVPFRFSGFSFDVTSTLVFFILAIVSLIEST
    NCTC8325        IGLVLGTIGAGLLGMVDINQVNHAGWLGIPVPFRFSGFSFDVTSTLVFFIVAIVSLIEST
    Newman          IGLVLGTIGAGLLGMVDINQVNHAGWLGIPVPFRFSGFSFDVTSTLVFFIVAIVSLIEST
    USA300_FPR3757  IGLVLGTIGAGLLGMVDINQVNHAGWLGIPVPFRFSGFSFDVTSTLVFFIVAIVSLIEST
                    **************************************************:*********

    COL             GVYHALSEITGKKLERKDFRKGYTAEGLAIVLGSIFNSFPYTAYSQNVGLVSLSGAKKNN
    N315            GVYHALSEITGKKLERKDFRKGYTAEGLAIVLGSIFNSFPYTAYSQNVGLVSLSGAKKNN
    NCTC8325        GVYHALSEITGKKLERKDFRKGYTAEGLAIVLGSIFNSFPYTAYSQNVGLVSLSGAKKNN
    Newman          GVYHALSEITGKKLERKDFRKGYTAEGLAIVLGSIFNSFPYTAYSQNVGLVSLSGAKKNN
    USA300_FPR3757  GVYHALSEITGKKLERKDFRKGYTAEGLAIVLGSIFNSFPYTAYSQNVGLVSLSGAKKNN
                    ************************************************************

    COL             VIYGMVVLLLICGCIPKLGALANIIPLPVLGGAMIAMFGMVMAYGVSILGHIDFKNQNNL
    N315            VIYGMVVLLLICGCIPKLGALANIIPLPVLGGAMIAMFGMVMAYGVSILGHIDFKNQNNL
    NCTC8325        VIYGMVVLLLICGCIPKLGALANIIPLPVLGGAMIAMFGMVMAYGVSILGHIDFKNQNNL
    Newman          VIYGMVVLLLICGCIPKLGALANIIPLPVLGGAMIAMFGMVMAYGVSILGHIDFKNQNNL
    USA300_FPR3757  VIYGMVVLLLICGCIPKLGALANIIPLPVLGGAMIAMFGMVMAYGVSILGHIDFKNQNNL
                    ************************************************************

    COL             LIIAVSVGLGTGISAVPQAFKGLGEQFAWLTQNGIVLGAISAIILNFFFNGIKYKQTEEN
    N315            LIIAVSVGLGTGISAVPQAFKGLGEQFAWLTQNGIVLGAISAIILNFFFNGIKYKQTEEN
    NCTC8325        LIIAVSVGLGTGISAVPQAFKGLGEQFAWLTQNGIVLGAISAIILNFFFNGIKYKQTEEN
    Newman          LIIAVSVGLGTGISAVPQAFKGLGEQFAWLTQNGIVLGAISAIILNFFFNGIKYKQTEEN
    USA300_FPR3757  LIIAVSVGLGTGISAVPQAFKGLGEQFAWLTQNGIVLGAISAIILNFFFNGIKYKQTEEN
                    ************************************************************

    COL             VK
    N315            VK
    NCTC8325        VK
    Newman          VK
    USA300_FPR3757  VK
                    **