From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001997000
  • symbol?: guaA
  • description?: GMP synthase

      descriptions from strain specific annotations:

    • GMP synthase
    • GMP synthase (glutamine-hydrolyzing)
    • GMP synthase [glutamine-hydrolyzing] (Glutamineamidotransferase) (GMP synthetase)
    • putative GMP synthase
    • bifunctional GMP synthase/glutamine amidotransferase protein
  • strand?: +
  • coordinates?: 2462091..2463632
  • synteny block?: BlockID0013500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0461 (guaA)
    N315:
    SA0376 (guaA)
    NCTC8325:
    Newman:
    NWMN_0381 (guaA)
    USA300_FPR3757:
    04-02981:
    SA2981_0389 (guaA)
    08BA02176:
    C248_0447 (guaA)
    11819-97:
    MS7_0380 (guaA)
    71193:
    ST398NM01_0468
    ECT-R 2:
    ECTR2_350 (guaA)
    ED133:
    SAOV_0413 (guaA)
    ED98:
    SAAV_0358 (guaA)
    HO 5096 0412:
    SAEMRSA15_03430 (guaA)
    JH1:
    SaurJH1_0449 (guaA)
    JH9:
    SaurJH9_0438 (guaA)
    JKD6008:
    SAA6008_00390 (guaA)
    JKD6159:
    SAA6159_00365 (guaA)
    LGA251:
    SARLGA251_03510 (guaA)
    M013:
    M013TW_0370
    MRSA252:
    SAR0409 (guaA)
    MSHR1132:
    SAMSHR1132_03620
    MSSA476:
    SAS0367 (guaA)
    Mu3:
    SAHV_0388 (guaA)
    Mu50:
    SAV0391 (guaA)
    MW2:
    MW0367 (guaA)
    RF122:
    SAB0341 (guaA)
    ST398:
    SAPIG0468
    T0131:
    SAT0131_00424
    TCH60:
    HMPREF0772_10103 (guaA)
    TW20:
    SATW20_04570 (guaA)
    USA300_TCH1516:
    USA300HOU_0414 (guaA)
    VC40:
    SAVC_01705 (guaA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEMAKEQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGP
    N315            MEMAKEQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGP
    NCTC8325        MEMAKEQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGP
    Newman          MEMAKEQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGP
    USA300_FPR3757  MEMAKEQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGP
                    ************************************************************

    COL             NSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVERANEREYGKAIINAKSDEL
    N315            NSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVERANEREYGKAIINAKSDEL
    NCTC8325        NSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVERANEREYGKAIINAKSDEL
    Newman          NSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVERANEREYGKAIINAKSDEL
    USA300_FPR3757  NSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVERANEREYGKAIINAKSDEL
                    ************************************************************

    COL             FAGLPAEQTVWMSHSDKVIEIPEGFEVIADSPSTDYAAIEDKKRRIYGVQFHPEVRHTEY
    N315            FAGLPAEQTVWMSHSDKVIEIPEGFEVIADSPSTDYAAIEDKKRRIYGVQFHPEVRHTEY
    NCTC8325        FAGLPAEQTVWMSHSDKVIEIPEGFEVIADSPSTDYAAIEDKKRRIYGVQFHPEVRHTEY
    Newman          FAGLPAEQTVWMSHSDKVIEIPEGFEVIADSPSTDYAAIEDKKRRIYGVQFHPEVRHTEY
    USA300_FPR3757  FAGLPAEQTVWMSHSDKVIEIPEGFEVIADSPSTDYAAIEDKKRRIYGVQFHPEVRHTEY
                    ************************************************************

    COL             GNDLLNNFVRRVCDCRGQWTMENFIEIEIEKIRQRVGDRRVLCAMSGGVDSSVVAVLLHK
    N315            GNDLLNNFVRRVCDCKGQWTMENFIEIEIEKIRQRVGDRRVLCAMSGGVDSSVVAVLLHK
    NCTC8325        GNDLLNNFVRRVCDCRGQWTMENFIEIEIEKIRQRVGDRRVLCAMSGGVDSSVVAVLLHK
    Newman          GNDLLNNFVRRVCDCRGQWTMENFIEIEIEKIRQRVGDRRVLCAMSGGVDSSVVAVLLHK
    USA300_FPR3757  GNDLLNNFVRRVCDCRGQWTMENFIEIEIEKIRQRVGDRRVLCAMSGGVDSSVVAVLLHK
                    ***************:********************************************

    COL             AIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFNMNIIRVNAKDRFMNKLKGVSDPEQKRK
    N315            AIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFNMNIIRVNAKDRFMNKLKGVSDPEQKRK
    NCTC8325        AIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFNMNIIRVNAKDRFMNKLKGVSDPEQKRK
    Newman          AIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFNMNIIRVNAKDRFMNKLKGVSDPEQKRK
    USA300_FPR3757  AIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFNMNIIRVNAKDRFMNKLKGVSDPEQKRK
                    ************************************************************

    COL             IIGNEFVYVFDDEASKLKGVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFEL
    N315            IIGNEFVYVFDDEASKLKGVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFEL
    NCTC8325        IIGNEFVYVFDDEASKLKGVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFEL
    Newman          IIGNEFVYVFDDEASKLKGVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFEL
    USA300_FPR3757  IIGNEFVYVFDDEASKLKGVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFEL
                    ************************************************************

    COL             IEPINTLFKDEVRKLGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILR
    N315            IEPINTLFKDEVRKLGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILR
    NCTC8325        IEPINTLFKDEVRKLGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILR
    Newman          IEPINTLFKDEVRKLGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILR
    USA300_FPR3757  IEPINTLFKDEVRKLGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILR
                    ************************************************************

    COL             QVIREEGLEREIWQYFTVLPNIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEV
    N315            QVIREEGLEREIWQYFTVLPNIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEV
    NCTC8325        QVIREEGLEREIWQYFTVLPNIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEV
    Newman          QVIREEGLEREIWQYFTVLPNIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEV
    USA300_FPR3757  QVIREEGLEREIWQYFTVLPNIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEV
                    ************************************************************

    COL             LQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE
    N315            LQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE
    NCTC8325        LQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE
    Newman          LQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE
    USA300_FPR3757  LQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE
                    *********************************