From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002055000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 2537878..2538418
  • synteny block?: BlockID0013770
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0390
    08BA02176:
    C248_0465
    11819-97:
    71193:
    ST398NM01_0484
    ECT-R 2:
    ECTR2_351
    ED133:
    SAOV_0432c
    ED98:
    SAAV_0359
    HO 5096 0412:
    JH1:
    SaurJH1_0450
    JH9:
    SaurJH9_0439
    JKD6008:
    SAA6008_00416
    JKD6159:
    SAA6159_00366
    LGA251:
    SARLGA251_03520
    M013:
    MRSA252:
    SAR0411
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0413
    Mu50:
    SAV0416
    MW2:
    RF122:
    ST398:
    SAPIG0484
    T0131:
    SAT0131_00451
    TCH60:
    HMPREF0772_10102
    TW20:
    SATW20_04890
    USA300_TCH1516:
    USA300HOU_0415
    VC40:
    SAVC_01710

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHNNNEFNKKLKDFIGSDKRMALVKGYVNEYKLTTVLRALNNSDYTKGTIHTRSIGNLKQ
    N315            MHNKNEFNKKLKDFIGSDKRMALVKGYINEYKLTTVLRALNNSDYTKGTIHTRSIGNLKQ
    NCTC8325        MHNNNEFNKKLKDFIGSDKRMALVKGYVNEYKLTTVLRALNNSDYTKGTIHTRSIGNLKQ
    Newman          MHNNNEFNKKLKDFIGSDKRMALVKGYVNEYKLTTVLRALNNSDYTKGTIHTRSIGNLKQ
    USA300_FPR3757  MHNNNEFNKKLKDFIGSDKRMALVKGYVNEYKLTTVLRALNNSDYTKGTIHTRSIGNLKQ
                    ***:***********************:********************************

    COL             IVDNRIIPKNITQNTIFKLSNLTLEVNLYERNTIYHGDFAIYYPVESALIIETDTPRLIN
    N315            IVDNRIIPKNITQNKIFKLSNLTLEVNLYERNTIYHGDFAIYYPVESALIIETDTPRLIN
    NCTC8325        IVDNRIIPKNITQNTIFKLSNLTLEVNLYERNTIYHGDFAIYYPVESALIIETDTPRLIN
    Newman          IVDNRIIPKNITQNTIFKLSNLTLEVNLYERNTIYHGDFAIYYPVESALIIETDTPRLIN
    USA300_FPR3757  IVDNRIIPKNITQNTIFKLSNLTLEVNLYERNTIYHGDFAIYYPVESALIIETDTPRLIN
                    **************.*********************************************

    COL             HINNNPVQKIFIITTNDWSFNTLELEKIVDETIIYDLKQEDPKQYEILYKNKHGKLPY
    N315            HINNNPVQKIFIITTNDWSFNTLELEKIVDETIIYDLKQEDPKQYEILYKNKHGKLPY
    NCTC8325        HINNNPVQKIFIITTNDWSFNTLELEKIVDETIIYDLKQEDPKQYEILYKNKHGKLPY
    Newman          HINNNPVQKIFIITTNDWSFNTLELEKIVDETIIYDLKQEDPKQYEILYKNKHGKLPY
    USA300_FPR3757  HINNNPVQKIFIITTNDWSFNTLELEKIVDETIIYDLKQEDPKQYEILYKNKHGKLPY
                    **********************************************************