From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002057000
  • symbol?:
  • description?: transposase

      descriptions from strain specific annotations:

    • transposase
    • transposase IS3/IS911 family protein
    • pseudogene
    • IS3 family transposase
    • transposase domain-containing protein
  • strand?: -
  • coordinates?: 2539972..2540835
  • synteny block?: BlockID0013790
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0384 (tnp)
    USA300_FPR3757:
    04-02981:
    SA2981_0392
    08BA02176:
    C248_0467
    11819-97:
    71193:
    ST398NM01_0486
    ECT-R 2:
    ECTR2_353
    ED133:
    ED98:
    SAAV_0361
    HO 5096 0412:
    JH1:
    SaurJH1_0452
    JH9:
    SaurJH9_0441
    JKD6008:
    SAA6008_00418
    JKD6159:
    SAA6159_00368
    LGA251:
    SARLGA251_03540
    M013:
    MRSA252:
    SAR0416
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0415
    Mu50:
    SAV0418
    MW2:
    RF122:
    ST398:
    SAPIG0486
    T0131:
    SAT0131_00453
    TCH60:
    TW20:
    SATW20_04910
    USA300_TCH1516:
    USA300HOU_0417
    VC40:
    SAVC_01720

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------MTKERRTFSSEFKLQMVRLYKNGKLKNEIIRKYDLKPSIISNSIKQHQNTGP
    N315            MKKVVNLIMTKERRTFSSEFKLQMVRLYKNGKLKNEIIRKYDLKPSIISNSIKQHQNTGP
    NCTC8325        --------MTKERRTFSSEFKLQMVRLYKNGKLKNEIIRKYDLKPSIISNSIKQHQNTGP
    Newman          --------MTKERRTFSSEFKLQMVRLYKNGKLKNEIIRKYDLKPSIISNSIKQHQNTGP
                            ****************************************************

    COL             FNHQDNLKSDEKELIKLRKEVQHLKMEHDVLKQILKLI
    N315            FNHQDNLKSDEKELIKLRKEVQHLKMEHDVLKQILKLI
    NCTC8325        FNHQDNLKSDEKELIKLRKEVQHLKMEHDVLKQILKLI
    Newman          FNHQDNLKSDEKELIKLRKEVQHLKMEHDVLKQILKLI
                    **************************************