From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002063000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 2544581..2544733
  • synteny block?: BlockID0013840
  • occurrence?: in 88% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0393
    08BA02176:
    C248_0468
    11819-97:
    MS7_0391
    71193:
    ST398NM01_0487
    ECT-R 2:
    ECTR2_354
    ED133:
    SAOV_0434c
    ED98:
    SAAV_0362
    HO 5096 0412:
    SAEMRSA15_03500
    JH1:
    SaurJH1_0454
    JH9:
    SaurJH9_0442
    JKD6008:
    SAA6008_00419
    JKD6159:
    SAA6159_00369
    LGA251:
    SARLGA251_03550
    M013:
    M013TW_0376
    MRSA252:
    SAR0418
    MSHR1132:
    SAMSHR1132_03690
    MSSA476:
    SAS0378
    Mu3:
    SAHV_0416
    Mu50:
    SAV0419
    MW2:
    MW0376
    RF122:
    ST398:
    SAPIG0487
    T0131:
    SAT0131_00454
    TCH60:
    HMPREF0772_10098
    TW20:
    SATW20_04920
    USA300_TCH1516:
    USA300HOU_0419
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVPEEKGSITLSKEAAIIFAIAKFKPFKNRIKNNPQKTNPFLKLHENKKS
    N315            MVPEEKGSITLSKEAAIIFATAKFKPFKNRIKNNPLKTNPFLKLHENKKS
    USA300_FPR3757  MVPEEKGSITLSKEAAIIFAIAKFKPFKNRIKNNPQKTNPFLKLHENKKS
                    ******************** ************** **************