From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002106000
  • symbol?: ssl2
  • description?: staphylococcal superantigen-like protein 2

      descriptions from strain specific annotations:

    • staphylococcal superantigen-like protein 2
    • superantigen-like protein
    • exotoxin
    • Exotoxin 7
    • Staphylococcal enterotoxin-like toxin
    • staphylococcal exotoxin
    • superantigen-like protein 11
  • strand?: +
  • coordinates?: 2589781..2590497
  • synteny block?: BlockID0014120
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0383 (set7)
    NCTC8325:
    Newman:
    NWMN_0389 (set2nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0397 (set7)
    08BA02176:
    C248_0473
    11819-97:
    MS7_0398
    71193:
    ST398NM01_0491
    ECT-R 2:
    ECTR2_358
    ED133:
    SAOV_0441
    ED98:
    SAAV_0366
    HO 5096 0412:
    SAEMRSA15_03540
    JH1:
    SaurJH1_0458
    JH9:
    SaurJH9_0446
    JKD6008:
    SAA6008_00423 (set7)
    JKD6159:
    SAA6159_00376 (set7)
    LGA251:
    SARLGA251_03610
    M013:
    M013TW_0384
    MRSA252:
    SAR0423
    MSHR1132:
    SAMSHR1132_03730
    MSSA476:
    SAS0385
    Mu3:
    SAHV_0420 (set7)
    Mu50:
    SAV0423 (set7)
    MW2:
    MW0383 (set17)
    RF122:
    SAB0377 (set10)
    ST398:
    SAPIG0491
    T0131:
    SAT0131_00458
    TCH60:
    HMPREF0772_10094
    TW20:
    SATW20_04970
    USA300_TCH1516:
    USA300HOU_0423 (set1)
    VC40:
    SAVC_01740

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYNQPSIEYKNVTG
    N315            MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYTQPSIEYKNVTG
    NCTC8325        MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYNQPSIEYKNVTG
    Newman          MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYNQPSIEYKNVTG
    USA300_FPR3757  MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYNQPSIEYKNVTG
                    ************************************************.***********

    COL             YISFIQPSIKFMNIIDGNSVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIG
    N315            YISFIQPSIKFMNIIDGNSVNNLALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIG
    NCTC8325        YISFIQPSIKFMNIIDGNSVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIG
    Newman          YISFIQPSIKFMNIIDGNSVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIG
    USA300_FPR3757  YISFIQPSIKFMNIIDGNSVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIG
                    **********************:*************************************

    COL             GITSANDKAVDLIAEARVIKEDHTGEYDYDFFPFKIDKEAMSLKEIDFKLRKYLIDNYGL
    N315            GITSANDKAVDLIAEARVIKADHIGEYDYDFFPFKIDKEAMSLKEIDFKLRKYLIDNYGL
    NCTC8325        GITSANDKAVDLIAEARVIKEDHTGEYDYDFFPFKIDKEAMSLKEIDFKLRKYLIDNYGL
    Newman          GITSANDKAVDLIAEARVIKEDHTGEYDYDFFPFKIDKEAMSLKEIDFKLRKYLIDNYGL
    USA300_FPR3757  GITSANDKAVDLIAEARVIKEDHTGEYDYDFFPFKIDKEAMSLKEIDFKLRKYLIDNYGL
                    ******************** ** ************************************

    COL             YGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVIKA
    N315            YGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVRKA
    NCTC8325        YGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVIKA
    Newman          YGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVIKA
    USA300_FPR3757  YGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVIKA
                    ************************************************ **