From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN002122000
  • symbol?: hsdS1
  • description?: restriction endonuclease subunit S

      descriptions from strain specific annotations:

    • restriction endonuclease subunit S
    • restriction modification system specificity subunit
    • type I restriction-modification system S subunit
    • type I restriction modification system, site specificity determination subunit
    • putative restriction/modification system specificity protein
    • EcoA family type I restriction-modification system
    • restriction and modification system specificity protein
    • restriction endonuclease S subunit
    • Restriction modification system DNA specificity domain protein
    • restriction modification system DNA specificity subunit
    • type I restriction modification DNA specificity domain protein
    • Type I restriction-modification system, specificity subunit S
    • type I restriction-modification system specificity protein
    • type I restriction-modification system subunit S
    • type I site-specific deoxyribonuclease specificity subunit
  • strand?: +
  • coordinates?: 2613264..2615281
  • synteny block?: BlockID0014280
  • occurrence?: in 59% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0392 (hsdS)
    NCTC8325:
    Newman:
    NWMN_0399 (hsdS)
    USA300_FPR3757:
    04-02981:
    SA2981_0408 (hsdS)
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_367
    ED133:
    ED98:
    SAAV_0375 (hsdS1)
    HO 5096 0412:
    JH1:
    SaurJH1_0467
    JH9:
    SaurJH9_0455
    JKD6008:
    SAA6008_00435 (hsdS)
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR0434
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0430 (hsdS)
    Mu50:
    SAV0432 (hsdS)
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_00471
    TCH60:
    HMPREF0772_10085
    TW20:
    SATW20_05090
    USA300_TCH1516:
    USA300HOU_0434 (hsdS1)
    VC40:
    SAVC_01790

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNTQKKNVPELRFPGFEGEWEEKQLGDLTDRVIRKNKNLESKKPLTISGQLGLIDQTEY
    N315            MSNTQKKNVPELRFPGFEGEWEEKQLGDLTDRVIRKNKNLESKKPLTISGQLGLIDQTEY
    NCTC8325        MSNTQKKNVPELRFPGFEGEWEEKQLGDLTDRVIRKNKNLESKKPLTISGQLGLIDQTEY
    Newman          MSNTQKKNVPELRFPGFEGEWEEKQLGDLTDRVIRKNKNLESKKPLTISGQLGLIDQTEY
    USA300_FPR3757  MSNTQKKNVPELRFPGFEGEWEEKQLGDLTDRVIRKNKNLESKKPLTISGQLGLIDQTEY
                    ************************************************************

    COL             FSKSVSSKNLENYTLIKNGEFAYNKSYSNGYPLGAIKRLTRYDSGVLSSLYICFSIKSEM
    N315            FSKSVSSKNLENYTLIKNGEFAYNKSYSNGYPLGAIKRLTRYDSGVLSSLYICFSIKSEM
    NCTC8325        FSKSVSSKNLENYTLIKNGEFAYNKSYSNGYPLGAIKRLTRYDSGVLSSLYICFSIKSEM
    Newman          FSKSVSSKNLENYTLIKNGEFAYNKSYSNGYPLGAIKRLTRYDSGVLSSLYICFSIKSEM
    USA300_FPR3757  FSKSVSSKNLENYTLIKNGEFAYNKSYSNGYPLGAIKRLTRYDSGVLSSLYICFSIKSEM
                    ************************************************************

    COL             SKDFMEAYFDSTHWYREVSGIAVEGARNHGLLNVSVNDFFTILIKYPSLEEQQKIGKFFS
    N315            SKDFMEAYFDSTHWYREVSGIAVEGARNHGLLNVSVNDFFTILIKYPSLEEQQKIGKFFS
    NCTC8325        SKDFMEAYFDSTHWYREVSGIAVEGARNHGLLNVSVNDFFTILIKYPSLEEQQKIGKFFS
    Newman          SKDFMEAYFDSTHWYREVSGIAVEGARNHGLLNVSVNDFFTILIKYPSLEEQQKIGKFFS
    USA300_FPR3757  SKDFMEAYFDSTHWYREVSGIAVEGARNHGLLNVSVNDFFTILIKYPSLEEQQKIGKFFS
                    ************************************************************

    COL             KLDRQIELEEQKLELLQQQKKGYMQKIFSQELRFKDENGEDYPDWENSKIEKYLKERNER
    N315            KLDRQIELEEQKLELLQQQKKGYMQKIFSQELRFKDENGEDYPDWENSKIEKYLKERNER
    NCTC8325        KLDRQIELEEQKLELLQQQKKGYMQKIFSQELRFKDENGEDYPDWENSKIEKYLKERNER
    Newman          KLDRQIELEEQKLELLQQQKKGYMQKIFSQELRFKDENGEDYPDWENSKIEKYLKERNER
    USA300_FPR3757  KLDRQIELEEQKLELLQQQKKGYMQKIFSQELRFKDENGEDYPDWENSKIEKYLKERNER
                    ************************************************************

    COL             SDKGQMLSVTINSGIIKFSELDRKDNSSKDKSNYKVVRKNDIAYNSMRMWQGASGKSNYN
    N315            SDKGQMLSVTINSGIIKFSELDRKDNSSKDKSNYKVVRKNDIAYNSMRMWQGASGKSNYN
    NCTC8325        SDKGQMLSVTINSGIIKFSELDRKDNSSKDKSNYKVVRKNDIAYNSMRMWQGASGKSNYN
    Newman          SDKGQMLSVTINSGIIKFSELDRKDNSSKDKSNYKVVRKNDIAYNSMRMWQGASGKSNYN
    USA300_FPR3757  SDKGQMLSVTINSGIIKFSELDRKDNSSKDKSNYKVVRKNDIAYNSMRMWQGASGKSNYN
                    ************************************************************

    COL             GIVSPAYTVLYPTQNTSSLFIGYKFKTHRMIHKFKINSQGLTSDTWNLKYKQLKNINIDI
    N315            GIVSPAYTVLYPTQNTSSLFIGYKFKTHRMIHKFKINSQGLTSDTWNLKYKQLKNINIDI
    NCTC8325        GIVSPAYTVLYPTQNTSSLFIGYKFKTHRMIHKFKINSQGLTSDTWNLKYKQLKNINIDI
    Newman          GIVSPAYTVLYPTQNTSSLFIGYKFKTHRMIHKFKINSQGLTSDTWNLKYKQLKNINIDI
    USA300_FPR3757  GIVSPAYTVLYPTQNTSSLFIGYKFKTHRMIHKFKINSQGLTSDTWNLKYKQLKNINIDI
                    ************************************************************

    COL             PVLEEQEKIGDFFKKMDILISKQKMKIEILEKEKQSFLQKMFL
    N315            PVLEEQEKIGDFFKKMDILISKQKMKIEILEKEKQSFLQKMFL
    NCTC8325        PVLEEQEKIGDFFKKMDILISKQKMKIEILEKEKQSFLQKMFL
    Newman          PVLEEQEKIGDFFKKMDILISKQKMKIEILEKEKQSFLQKMFL
    USA300_FPR3757  PVLEEQEKIGDFFKKMDILISKQKMKIEILEKEKQSFLQKMFL
                    *******************************************