From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002132000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 2626491..2626799
  • synteny block?: BlockID0014380
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0411
    08BA02176:
    C248_0487
    11819-97:
    MS7_0410
    71193:
    ST398NM01_0503
    ECT-R 2:
    ECTR2_370
    ED133:
    SAOV_0455c
    ED98:
    SAAV_0378
    HO 5096 0412:
    SAEMRSA15_03650
    JH1:
    SaurJH1_0470
    JH9:
    SaurJH9_0458
    JKD6008:
    SAA6008_00438
    JKD6159:
    LGA251:
    SARLGA251_03730
    M013:
    M013TW_0396
    MRSA252:
    SAR0437
    MSHR1132:
    MSSA476:
    SAS0398
    Mu3:
    SAHV_0433
    Mu50:
    SAV0435
    MW2:
    MW0396
    RF122:
    SAB0388c
    ST398:
    SAPIG0503
    T0131:
    SAT0131_00474 (argC)
    TCH60:
    HMPREF0772_10082
    TW20:
    SATW20_05120
    USA300_TCH1516:
    USA300HOU_0437
    VC40:
    SAVC_01805

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MKFKKVLVATAMVGVLATGVVGYGNQADAKVYSQNGLVLHDDANFLEHELSYIDVLL
    N315            ---MKFKKVLVATAMVGVLATGVVGYGNQADAKVYSQNGLVLHDDANFLEHELSYIDVLL
    NCTC8325        ---MKFKKVLVATAMVGVLATGVVGYGNQADAKVYSQNGLVLHDDANFLEHELSYIDVLL
    Newman          MIDMKFKKVLVATAMVGVLATGVVGYGNQADAKVYSQNGLVLHDDANFLEHELSYIDVLL
    USA300_FPR3757  ---MKFKKVLVATAMVGVLATGVVGYGNQADAKVYSQNGLVLHDDANFLEHELSYIDVLL
                       *********************************************************

    COL             DKNADQATKDNLRSYFADKGLHSIKDIINKAKQDGFDVSKYEHVK
    N315            DKNADQATKDNLRSYFADKGLHSIKDIINKAKQDGFDVSKYEHVK
    NCTC8325        DKNADQATKDNLRSYFADKGLHSIKDIINKAKQDGFDVSKYEHVK
    Newman          DKNADQATKDNLRSYFADKGLHSIKDIINKAKQDGFDVSKYEHVK
    USA300_FPR3757  DKNADQATKDNLRSYFADKGLHSIKDIINKAKQDGFDVSKYEHVK
                    *********************************************