From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN002134000
  • symbol?: lpl1
  • description?: lipoprotein

      descriptions from strain specific annotations:

    • lipoprotein
    • Tandem lipoprotein within Pathogenicity island 2
    • staphylococcus tandem lipoproteins family protein
    • putative lipoprotein
    • staphylococcal tandem lipoprotein
  • strand?: +
  • coordinates?: 2627137..2641015
  • synteny block?: BlockID0014400
  • occurrence?: in 44% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0396 (lpl1)
    NCTC8325:
    Newman:
    NWMN_0403 (lpl1nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0412 (lpl1)
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_371
    ED133:
    SAOV_0458
    ED98:
    SAAV_0379
    HO 5096 0412:
    JH1:
    SaurJH1_0471
    JH9:
    SaurJH9_0459
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_03800
    M013:
    MRSA252:
    SAR0439
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0434 (lpl1)
    Mu50:
    SAV0436 (lpl1)
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0438 (lpl11)
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MKYKTKRRETMRYLKRLSWYISILILIVVIAGCGKGNETKEGSKEEQIKKSFAKTLDMYP
    Newman          MKYKTERREAMGYLKRFALYISVMILIFAIAGCGKGNETKEDSKEEQIKKSFAKTLDMYP
    USA300_FPR3757  MKYKTERREAMGYLKRFALYISVMILIFAIAGCGKGNETKEDSKEEQIKKSFAITLDMYP
                    *****:***:* ****:: ***::***..************.*********** ******

    N315            IKNLEDLYDKEGYRDSEFKKSDKGTWTIYTDFAKSNKPGELDDEGMVLNLDRNTRTAKGH
    Newman          IKNLEDLYDKEGYRDSEFKKGDKGMWTIYTDFAKSNKPGELDDEGMVLNLDRNTRTAKGH
    USA300_FPR3757  IKNLEDLYDKEGYRDSEFKKGDKGMWTIYTDFAKSNKPGELDDEGMVLNLDRNTRTAKGH
                    ********************.*** ***********************************

    N315            YFVTTFYRNGKLPDEKNYKIEMKNNKIILLDEVKDDKLKQKIENFKFFGQYANLKELRKY
    Newman          YFVTTFYRNGKLPDEKNYKIEMKNNKIILLDEVKDDKLKQKIENFKFFGQYANLKELRKY
    USA300_FPR3757  YFVTTFYRNGKLPDEKNYKIEMKNNKIILLDEVKDDKLKQKIENFKFFGQYANLKELRKY
                    ************************************************************

    N315            NNGDVSINENVPSYDVEYKMSNKDEIVKELRSRYNISTEKSPILKMHIDGDLKGSSVGYR
    Newman          NNGDVSINENVPSYDVEYKMSNKDEIVKELRSRYNISTEKSPILKMHIDGDLKGSSVGYR
    USA300_FPR3757  NNGDVSINENVPSYDVEYKMSNKDEIVKELRSRYNISTEKSPILKMHIDGDLKGSSVGYR
                    ************************************************************

    N315            KLEIDFSKRENSKLSVIEFLSYKPAKK
    Newman          KLEIDFSKRENSKLSVIEFLSYKPAKK
    USA300_FPR3757  KLEIDFSKRENSKLSVIEFLSYKPAKK
                    ***************************