From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN002140000
  • symbol?: lpl6
  • description?: tandem-type lipoprotein

      descriptions from strain specific annotations:

    • tandem-type lipoprotein
    • tandem lipoprotein
    • staphyloccoccus tandem lipoprotein
    • pseudogene
    • putative lipoprotein
    • staphylococcus tandem lipoproteins family protein
  • strand?: +
  • coordinates?: 2642891..2643652
  • synteny block?: BlockID0014460
  • occurrence?: in 47% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0409 (lpl6nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0415
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_374
    ED133:
    ED98:
    SAAV_0382
    HO 5096 0412:
    SAEMRSA15_03690
    JH1:
    SaurJH1_0474
    JH9:
    SaurJH9_0462
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0402
    Mu3:
    SAHV_0437
    Mu50:
    SAV0439
    MW2:
    MW0400 (lpl13)
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0444
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKCFQKLYIFILILIVLMAGCESNKITGDSKETQIKKSFAKTLDVYPTKNLEDFYDKEGY
    N315            ------------------------------------------------------------
    Newman          MKCFQKLYIFILILIVLMAGCESNKITGDSKETQIKKSFAKTLDVYPTKNLEDFYDKEGY
    USA300_FPR3757  MKCFQKLYIFILILIVLMAGCESNKITGDSKETQIKKSFAKTLDVYPTKNLEDFYDKEGY
                                                                                

    COL             RDGEFKKGDKGKWVIRSEMTTELKNENMVSKGMVIRLNRNSRTCTGEYFVRIVKEDSEGK
    N315            ------------------------------------MNRNTRTTTGYFSIEEIDSRKSLD
    Newman          RDGEFKKGDKGKWVIRSEMTTELKNENMVSKGMVIRLNRNSRTCTGEYFVRIVKEDSEGK
    USA300_FPR3757  RDGEFKKGDKGKWVIRSEMTTELKNENMVSKGMVIRLNRNSRTCTGEYFVRIVKEDSEGK
                                                        :***:** ** : :. :.. .. .

    COL             VYSDERKYPVKMENNKIITLKPIDDEKVKKEIEEFKFFVQYGNFKELENYKDGEVTYNPE
    N315            ERETEKKYPVKMINNKIIPTEEIKDEKLKKEIENFKFFVQYGSFKGIENYENGDISYNSE
    Newman          VYSDERKYPVKMENNKIITLKPIDDEKVKKEIEEFKFFVQYGNFKELENYKDGEVTYNPE
    USA300_FPR3757  VYSDERKYPVKMENNKIITLKPIDDEKVKKEIEEFKFFVQYGNFKELENYKDGEVTYNPE
                      . *:****** *****. : *.***:*****:********.** :***::*:::**.*

    COL             APIYSAQYQLKNSDYNVEQLRKRYNITTKKAPKLLLKGSGNLKGSSVGYKNIEFTFVENK
    N315            APIYSAKYKLKNDDYNVKELRKRYNIPTEKAPKLLLKGSGDLKGSSVGYKEIEFIFIENK
    Newman          APIYSAQYQLKNSDYNVEQLRKRYNITTKKAPKLLLKGSGNLKGSSVGYKNIEFTFVENK
    USA300_FPR3757  APIYSAQYQLKNSDYNVEQLRKRYNITTKKAPKLLLKGSGNLKGSSVGYKNIEFTFVENK
                    ******:*:***.****::*******.*:***********:*********:*** *:***

    COL             EENIYFTDSINFNPSEDK
    N315            KENIYFSDGLNLIPSD--
    Newman          EENIYFTDSINFNPSEDK
    USA300_FPR3757  EENIYFTDSINFNPSEDK
                    :*****:*.:*: **: