From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002146000
  • symbol?:
  • description?: lipase family protein

      descriptions from strain specific annotations:

    • lipase family protein
    • pseudogene
  • strand?: +
  • coordinates?: 2653297..2662055
  • synteny block?: BlockID0014520
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0422
    08BA02176:
    11819-97:
    MS7_0420
    71193:
    ECT-R 2:
    ECTR2_381
    ED133:
    SAOV_0459
    ED98:
    SAAV_0389
    HO 5096 0412:
    SAEMRSA15_03710
    JH1:
    SaurJH1_0481
    JH9:
    SaurJH9_0469
    JKD6008:
    SAA6008_00449
    JKD6159:
    LGA251:
    SARLGA251_03810
    M013:
    M013TW_0409
    MRSA252:
    SAR0446
    MSHR1132:
    MSSA476:
    SAS0404
    Mu3:
    SAHV_0444
    Mu50:
    SAV0446
    MW2:
    MW0402
    RF122:
    SAB0397
    ST398:
    T0131:
    SAT0131_00484
    TCH60:
    HMPREF0772_10076
    TW20:
    SATW20_05150
    USA300_TCH1516:
    USA300HOU_0448
    VC40:
    SAVC_01825

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MSRKYKIDLKAINQNTESTSAISKASYEVENANNNGLSKRDVINQFNDLKKMKKFPSNL
    N315            -MKDKYKIDPGIIKNNTEETTAISKISYEVENANLYGADSEDITRQIEYLKAKKKFPSNL
    NCTC8325        MLSRKYKIDLKAINQNTESTSAISKASYEVENANNNGLSKRDVINQFNDLKKMKKFPSNL
    Newman          MLSRKYKIDLKAINQNTESTSAISKASYEVENANNNGLSKRDVINQFNDLKKMKKFPSNL
    USA300_FPR3757  MLSRKYKIDLKAINQNTESTSAISKASYEVENANNNGLSKRDVINQFNDLKKMKKFPSNL
                     :. *****   *::***.*:**** ********  * ...*: .*:: **  *******

    COL             EYVDSYTDSLTGVTTSAFLNKDTGKVTLGMTGTNLQDEAFKKLKEGEFSRQNVTNALETV
    N315            EYVDSYTDSLNGVTTSAFLNKDTGKVTLGMTGTNIQGEAFKKLKEGEFSRQNVTNALETV
    NCTC8325        EYVDSYTDSLTGVTTSAFLNKDTGKVTLGMTGTNLQDEAFKKLKEGEFSRQNVTNALETV
    Newman          EYVDSYTDSLTGVTTSAFLNKDTGKVTLGMTGTNLQDEAFKKLKEGEFSRQNVTNALETV
    USA300_FPR3757  EYVDSYTDSLTGVTTSAFLNKDTGKVTLGMTGTNLQDEAFKKLKEGEFSRQNVTNALETV
                    **********.***********************:*.***********************

    COL             KDGYADLKILYSPASDQNYRYANTQEFINKIKSKYDIDFITGHSLGGRDAVVLGMSNGIP
    N315            KDGYADLKILYSPASDQNYRYANTQEFINKIKSKYDIDFITGHSLGGRDAVVLGMSNGIP
    NCTC8325        KDGYADLKILYSPASDQNYRYANTQEFINKIKSKYDIDFITGHSLGGRDAVVLGMSNGIP
    Newman          KDGYADLKILYSPASDQNYRYANTQEFINKIKSKYDIDFITGHSLGGRDAVVLGMSNGIP
    USA300_FPR3757  KDGYADLKILYSPASDQNYRYANTQEFINKIKSKYDIDFITGHSLGGRDAVVLGMSNGIP
                    ************************************************************

    COL             NIVVYNPAPISITSLNPNSPDGKRLLELYKNYKGNITRFVAENDALTENLKKYKHYVFFG
    N315            NIVVYNPAPISINSLNPNSPDGKRLLELYKNYKGNITRFVAENDALTENLKKYKHYVFFG
    NCTC8325        NIVVYNPAPISITSLNPNSPDGKRLLELYKNYKGNITRFVAENDALTENLKKYKHYVFFG
    Newman          NIVVYNPAPISITSLNPNSPDGKRLLELYKNYKGNITRFVAENDALTENLKKYKHYVFFG
    USA300_FPR3757  NIVVYNPAPISITSLNPNSPDGKRLLELYKNYKGNITRFVAENDALTENLKKYKHYVFFG
                    ************.***********************************************

    COL             NDKVFKNGKGHEMEGFLTEEEQKAIKKELKKLQGYAEENNKSFVKNSNNAISKLASIELL
    N315            NDKVFKNGKGHEMEGFLTEEEQKAIKKELKKLQGYAEENNKSFVKNSNNAISKLASIELL
    NCTC8325        NDKVFKNGKGHEMEGFLTEEEQKAIKKELKKLQGYAEENNKSFVKNSNNAISKLASIELL
    Newman          NDKVFKNGKGHEMEGFLTEEEQKAIKKELKKLQGYAEENNKSFVKNSNNAISKLASIELL
    USA300_FPR3757  NDKVFKNGKGHEMEGFLTEEEQKAIKKELKKLQGYAEENNKSFVKNSNNAISKLASIELL
                    ************************************************************

    COL             RANMMTTNGGGLSSSQQKVLESLTALTIAQSFSQLIDDEINQIKKMYNEKKKKFGKNWED
    N315            RANMMTTNGGGLSSSQQKVLESLTALTIAQSFSQLIDDEINQIKKMYNEKKKEFGKNWED
    NCTC8325        RANMMTTNGGGLSSSQQKVLESLTALTIAQSFSQLIDDEINQIKKMYNEKKKKFGKNWED
    Newman          RANMMTTNGGGLSSSQQKVLESLTALTIAQSFSQLIDDEINQIKKMYNEKKKKFGKNWED
    USA300_FPR3757  RANMMTTNGGGLSSSQQKVLESLTALTIAQSFSQLIDDEINQIKKMYNEKKKKFGKNWED
                    ****************************************************:*******

    COL             AQKAGKAVGEDLSVNGVLNALDEGQVNESSMVREPEQMISAKERQLSTIGSSVSNYIMRV
    N315            AQKAGKAVGEDLSVNGVLNALDEGQVNESSMVREPEQMISAKERQLSTIGSSVSNYIMRV
    NCTC8325        AQKAGKAVGEDLSVNGVLNALDEGQVNESSMVREPEQMISAKERQLSTIGSSVSNYIMRV
    Newman          AQKAGKAVGEDLSVNGVLNALDEGQVNESSMVREPEQMISAKERQLSTIGSSVSNYIMRV
    USA300_FPR3757  AQKAGKAVGEDLSVNGVLNALDEGQVNESSMVREPEQMISAKERQLSTIGSSVSNYIMRV
                    ************************************************************

    COL             RLSINEIVDKDQVLASQIGGLL
    N315            RLSINEIVDKDQVLASQIGGLL
    NCTC8325        RLSINEIVDKDQVLASQIGGLL
    Newman          RLSINEIVDKDQVLASQIGGLL
    USA300_FPR3757  RLSINEIVDKDQVLASQIGGLL
                    **********************