From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002166000
  • symbol?: mpsC
  • description?: conserved protein YbcLA
  • strand?: +
  • coordinates?: 2672357..2672719
  • synteny block?: BlockID0014670
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0430
    08BA02176:
    C248_0504
    11819-97:
    MS7_0427
    71193:
    ST398NM01_0520
    ECT-R 2:
    ECTR2_388
    ED133:
    SAOV_0471
    ED98:
    SAAV_0397
    HO 5096 0412:
    SAEMRSA15_03790
    JH1:
    SaurJH1_0489
    JH9:
    SaurJH9_0476
    JKD6008:
    SAA6008_00457
    JKD6159:
    SAA6159_00405
    LGA251:
    M013:
    M013TW_0418
    MRSA252:
    SAR0454
    MSHR1132:
    SAMSHR1132_03990
    MSSA476:
    SAS0412
    Mu3:
    SAHV_0452
    Mu50:
    SAV0454
    MW2:
    MW0409
    RF122:
    SAB0404
    ST398:
    SAPIG0520
    T0131:
    SAT0131_00492
    TCH60:
    HMPREF0772_10068
    TW20:
    SATW20_05230
    USA300_TCH1516:
    USA300HOU_0459
    VC40:
    SAVC_01860

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRTKGEIEAEISKAITQWEKDFLGRGSLSVKSDILRDMVIISLQGILTPAEYRVCSTNE
    N315            MKRTKGEIEAEISKAITQWEKDFLGRGSLSVKSDILRDMVIISLQGILTPAEYRVCSTNE
    NCTC8325        MKRTKGEIEAEISKAITQWEKDFLGRGSLSVKSDILRDMVIISLQGILTPAEYRVCSTNE
    Newman          MKRTKGEIEAEISKAITQWEKDFLGRGSLSVKSDILRDMVIISLQGILTPAEYRVCSTNE
    USA300_FPR3757  MKRTKGEIEAEISKAITQWEKDFLGRGSLSVKSDILRDMVIISLQGILTPAEYRVCSTNE
                    ************************************************************

    COL             GLLNIKRTRSELVESGEQDLNDIIFKITGIKVMSFHSDLSTVTGERIIVFKLEDNLEKHI
    N315            GLLNIKRTRSELVESGEQDLNDIILKITGIKVMSFHSDLSTVTGERIIVFKLEDNLEKHI
    NCTC8325        GLLNIKRTRSELVESGEQDLNDIIFKITGIKVMSFHSDLSTVTGERIIVFKLEDNLEKHI
    Newman          GLLNIKRTRSELVESGEQDLNDIIFKITGIKVMSFHSDLSTVTGERIIVFKLEDNLEKHI
    USA300_FPR3757  GLLNIKRTRSELVESGEQDLNDIIFKITGIKVMSFHSDLSTVTGERIIVFKLEDNLEKHI
                    ************************:***********************************