From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002167000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 2673184..2673426
  • synteny block?: BlockID0014680
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0431
    08BA02176:
    C248_0505
    11819-97:
    MS7_0428
    71193:
    ST398NM01_0521
    ECT-R 2:
    ECTR2_389
    ED133:
    SAOV_0472c
    ED98:
    SAAV_0398
    HO 5096 0412:
    SAEMRSA15_03800
    JH1:
    SaurJH1_0490
    JH9:
    SaurJH9_0477
    JKD6008:
    SAA6008_00458
    JKD6159:
    LGA251:
    SARLGA251_03890
    M013:
    M013TW_0419
    MRSA252:
    SAR0455
    MSHR1132:
    MSSA476:
    SAS0413
    Mu3:
    SAHV_0453
    Mu50:
    SAV0455
    MW2:
    RF122:
    SAB0405c
    ST398:
    SAPIG0521
    T0131:
    SAT0131_00493
    TCH60:
    HMPREF0772_10067
    TW20:
    SATW20_05240
    USA300_TCH1516:
    USA300HOU_0460
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----------------------MLCILQIKHCIIEITIFCYFQFSTIYIYYTEGVRRIN
    N315            ----------------------------------------------------------MN
    NCTC8325        MLSIISMCHKFHFTDNIKIIKFILLCILQIKHCIIEITIFCYFQFSTIYIYYTEGVRRIN
    USA300_FPR3757  MLSIISMCHKFHFTDNIKIIKFILLCILQIKHCIIEITIFCYFQFSTIYIYYTEGVRRIN
                                                                              :*

    COL             RVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPN
    N315            RVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPN
    NCTC8325        RVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPN
    USA300_FPR3757  RVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPN
                    ************************************************************

    COL             FLGILYRLYAYVTHILFM
    N315            FLGILYRLYAYVTHILFM
    NCTC8325        FLGILYRLYAYVTHILFM
    USA300_FPR3757  FLGILYRLYAYVTHILFM
                    ******************