From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002180000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 2684756..2685025
  • synteny block?: BlockID0014810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0441
    08BA02176:
    C248_0515
    11819-97:
    MS7_0439
    71193:
    ST398NM01_0531
    ECT-R 2:
    ECTR2_399
    ED133:
    SAOV_0483c
    ED98:
    SAAV_0408
    HO 5096 0412:
    SAEMRSA15_03910
    JH1:
    SaurJH1_0500
    JH9:
    SaurJH9_0487
    JKD6008:
    SAA6008_00469
    JKD6159:
    SAA6159_00415
    LGA251:
    SARLGA251_03990
    M013:
    M013TW_0430
    MRSA252:
    SAR0465
    MSHR1132:
    SAMSHR1132_04100
    MSSA476:
    SAS0423
    Mu3:
    SAHV_0463
    Mu50:
    SAV0466
    MW2:
    MW0420
    RF122:
    SAB0415c
    ST398:
    SAPIG0531
    T0131:
    SAT0131_00506
    TCH60:
    HMPREF0772_10057
    TW20:
    SATW20_05340
    USA300_TCH1516:
    USA300HOU_0466
    VC40:
    SAVC_01915

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MAKRSKSQRLSSLLNVAGFIVDGYNGYKYHAKNKKLVYLSLGLSTVGTVLDFYISIK
    N315            MIIMAKRSKSQRLSSLLNVAGFIVDGYNGYKYHAKNKKLVYLSLGLSTVGTVLDFYISIK
    NCTC8325        ---MAKRSKSQRLSSLLNVAGFIVDGYNGYKYHAKNKKLVYLSLGLSTVGTVLDFYISIK
    Newman          ---MAKRSKSQRLSSLLNVAGFIVDGYNGYKYHAKNKKLVYLSLGLSTVGTVLDFYISIK
    USA300_FPR3757  ---MAKRSKSQRLSSLLNVAGFIVDGYNGYKYHAKNKKLVYLSLGLSTVGTVLDFYISIK
                       *********************************************************

    COL             SPRKFKKAVAVVTLITNGARLFTSIRKVKHEY
    N315            SPRKFKKAVAVVTLITNGARLFTSIRKVKHEY
    NCTC8325        SPRKFKKAVAVVTLITNGARLFTSIRKVKHEY
    Newman          SPRKFKKAVAVVTLITNGARLFTSIRKVKHEY
    USA300_FPR3757  SPRKFKKAVAVVTLITNGARLFTSIRKVKHEY
                    ********************************