From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002184000
  • symbol?:
  • description?: yibE/F-like family protein

      descriptions from strain specific annotations:

    • yibE/F-like family protein
    • membrane spanning protein
  • strand?: -
  • coordinates?: 2687023..2688135
  • synteny block?: BlockID0014850
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0445
    08BA02176:
    C248_0519
    11819-97:
    MS7_0443
    71193:
    ST398NM01_0535
    ECT-R 2:
    ECTR2_403
    ED133:
    SAOV_0487c
    ED98:
    SAAV_0412
    HO 5096 0412:
    SAEMRSA15_03950
    JH1:
    SaurJH1_0504
    JH9:
    SaurJH9_0491
    JKD6008:
    SAA6008_00473
    JKD6159:
    SAA6159_00419
    LGA251:
    SARLGA251_04030
    M013:
    M013TW_0434
    MRSA252:
    SAR0469
    MSHR1132:
    SAMSHR1132_04140
    MSSA476:
    SAS0427
    Mu3:
    SAHV_0467
    Mu50:
    SAV0470
    MW2:
    MW0424
    RF122:
    SAB0419c
    ST398:
    SAPIG0535
    T0131:
    SAT0131_00511
    TCH60:
    HMPREF0772_10053
    TW20:
    SATW20_05380
    USA300_TCH1516:
    USA300HOU_0470
    VC40:
    SAVC_01935

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MKYRNLFTKPFNIILGLFCIAFIGAILFTFNNENFYNKPIGQIIDVKHVSSTPTKDAQ
    N315            --MKYRNLFTKPFNIILGLFCIAFIGAILFTFNNENFYNKPIGQIIDVKHVSSTPTKDAQ
    NCTC8325        MFLKYRNLFTKPFNIILGLFCIAFIGAILFTFNNENFYNKPIGQIIDVKHVSSTPTKDAQ
    Newman          MFLKYRNLFTKPFNIILGLFCIAFIGAILFTFNNENFYNKPIGQIIDVKHVSSTPTKDAQ
    USA300_FPR3757  --MKYRNLFTKPFNIILGLFCIAFIGAILFTFNNENFYNKPIGQIIDVKHVSSTPTKDAQ
                      :*********************************************************

    COL             NNRDIKYKNQLKVKILNGQFAGETTTINHQYVKSQADSEAFRTHEKVLLHISNKPSDAYI
    N315            NNRDIKYKNQLKVKILNGQFAGETTTINHQYVKSQADSEAFRTHEKVLLHISNKPSDAYI
    NCTC8325        NNRDIKYKNQLKVKILNGQFAGETTTINHQYVKSQADSEAFRTHEKVLLHISNKPSDAYI
    Newman          NNRDIKYKNQLKVKILNGQFAGETTTINHQYVKSQADSEAFRTHEKVLLHISNKPSDAYI
    USA300_FPR3757  NNRDIKYKNQLKVKILNGQFAGETTTINHQYVKSQADSEAFRTHEKVLLHISNKPSDAYI
                    ************************************************************

    COL             IEKKRDTLTVIITGLFLLTVLLVGRKVGLQSILSLILNSIAILIAIYIHIQHSNINLFLL
    N315            IEKKRDTLTVIITGLFLLTVLLVGRKVGLQSILSLILNSIAILIAIYIHIQHSNINLFLL
    NCTC8325        IEKKRDTLTVIITGLFLLTVLLVGRKVGLQSILSLILNSIAILIAIYIHIQHSNINLFLL
    Newman          IEKKRDTLTVIITGLFLLTVLLVGRKVGLQSILSLILNSIAILIAIYIHIQHSNINLFLL
    USA300_FPR3757  IEKKRDTLTVIITGLFLLTVLLVGRKVGLQSILSLILNSIAILIAIYIHIQHSNINLFLL
                    ************************************************************

    COL             MTIAMICSTILTLLLVTGWHMRTLITIASTIIGTFLSIGLTELIIYMTDGKGIKYETMNF
    N315            MTIAMICSTILTLLLVTGWHMRTLITIASTIIGTFLSIGLTELIIYMTDGKGIKYETMNF
    NCTC8325        MTIAMICSTILTLLLVTGWHMRTLITIASTIIGTFLSIGLTELIIYMTDGKGIKYETMNF
    Newman          MTIAMICSTILTLLLVTGWHMRTLITIASTIIGTFLSIGLTELIIYMTDGKGIKYETMNF
    USA300_FPR3757  MTIAMICSTILTLLLVTGWHMRTLITIASTIIGTFLSIGLTELIIYMADGKGIKYETMNF
                    ***********************************************:************

    COL             LSLPPKDIFLASVLIGSLGAIMDVAITIASGMHEILQRTPHISMRRWALAGRNIGQDIMG
    N315            LSLPPKDIFLASVLIGSLGAIMDVAITIASGMHEILQRTPHISMRRWALAGRNIGQDIMG
    NCTC8325        LSLPPKDIFLASVLIGSLGAIMDVAITIASGMHEILQRTPHISMRRWALAGRNIGQDIMG
    Newman          LSLPPKDIFLASVLIGSLGAIMDVAITIASGMHEILQRTPHISMRRWALAGRNIGQDIMG
    USA300_FPR3757  LSLPPKDIFLASVLIGSLGAIMDVAITIASGMHEILQRTPHISMRRWALAGRNIGQDIMG
                    ************************************************************

    COL             TMTNILLFSYLSGALPMFLIFLKNANTVTYTISMNWSLEIARALTGGIGIVLTIPITILF
    N315            TMTNILLFSYLSGALPMFLIFLKNANTVTYTISMNWSLEIARALTGGIGIVLTIPITILF
    NCTC8325        TMTNILLFSYLSGALPMFLIFLKNANTVTYTISMNWSLEIARALTGGIGIVLTIPITILF
    Newman          TMTNILLFSYLSGALPMFLIFLKNANTVTYTISMNWSLEIARALTGGIGIVLTIPITILF
    USA300_FPR3757  TMTNILLFSYLSGALPMFLIFLKNANTVTYTISMNWSLEIARALTGGIGIVLTIPITILF
                    ************************************************************

    COL             MEIFETLRRAKQ
    N315            MEIFETLRRAKQ
    NCTC8325        MEIFETLRRAKQ
    Newman          MEIFETLRRAKQ
    USA300_FPR3757  MEIFETLRRAKQ
                    ************