From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002186000
  • symbol?: gltB
  • description?: glutamate synthase large subunit

      descriptions from strain specific annotations:

    • glutamate synthase large subunit
    • glutamate synthase, large subunit
    • Glutamate synthase [NADPH] large chain
    • glutamate synthase [NADPH] large chain (NADPH-GOGAT)
    • glutamate synthase (NADPH), large subunit
    • ferredoxin-dependent glutamate synthase 1
    • glutamate synthase [NADPH] large subunit
    • glutamate synthase subunit alpha
    • glutamate synthase large chain
  • strand?: +
  • coordinates?: 2689313..2693821
  • synteny block?: BlockID0014870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0514 (gltB)
    N315:
    SA0430 (gltB)
    NCTC8325:
    Newman:
    NWMN_0436 (gltB)
    USA300_FPR3757:
    04-02981:
    SA2981_0447 (gltB)
    08BA02176:
    C248_0521 (gltA)
    11819-97:
    MS7_0445 (gltB)
    71193:
    ST398NM01_0537
    ECT-R 2:
    ECTR2_405
    ED133:
    SAOV_0489
    ED98:
    SAAV_0414 (gltB)
    HO 5096 0412:
    SAEMRSA15_03970 (gltA)
    JH1:
    SaurJH1_0506
    JH9:
    SaurJH9_0493
    JKD6008:
    SAA6008_00475 (gltB)
    JKD6159:
    SAA6159_00421 (gltB)
    LGA251:
    SARLGA251_04050 (gltA)
    M013:
    M013TW_0436
    MRSA252:
    SAR0471 (gltA)
    MSHR1132:
    SAMSHR1132_04160
    MSSA476:
    SAS0429
    Mu3:
    SAHV_0469 (gltB)
    Mu50:
    SAV0472 (gltB)
    MW2:
    MW0426 (gltB)
    RF122:
    SAB0421 (gltA)
    ST398:
    SAPIG0537
    T0131:
    SAT0131_00513 (leuS)
    TCH60:
    HMPREF0772_10051 (gltB)
    TW20:
    SATW20_05400 (gltA)
    USA300_TCH1516:
    USA300HOU_0472 (gltB1)
    VC40:
    SAVC_01945

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHNEKLIKGLYDYREEHDACGIGFYANMDNKRSHDIIDKSLEMLRRLDHRGGVGADGITG
    N315            MHNEKLIKGLYDYREEHDACGIGFYANMDNKRSHDIIDKSLEMLRRLDHRGGVGADGITG
    NCTC8325        MHNEKLIKGLYDYREEHDACGIGFYANMDNKRSHDIIDKSLEMLRRLDHRGGVGADGITG
    Newman          MHNEKLIKGLYDYREEHDACGIGFYANMDNKRSHDIIDKSLEMLRRLDHRGGVGADGITG
    USA300_FPR3757  MHNEKLIKGLYDYREEHDACGIGFYANMDNKRSHDIIDKSLEMLRRLDHRGGVGADGITG
                    ************************************************************

    COL             DGAGIMTEIPFAFFKQHVTDFDIPGEGEYAVGLFFSKERILGSEHEVVFKKYFEGEGLSI
    N315            DGAGIMTEIPFAFFKQHVTDFDIPGEGEYAVGLFFSKERILGSEHEAVFKKYFEGEGLSI
    NCTC8325        DGAGIMTEIPFAFFKQHVTDFDIPGEGEYAVGLFFSKERILGSEHEVVFKKYFEGEGLSI
    Newman          DGAGIMTEIPFAFFKQHVTDFDIPGEGEYAVGLFFSKERILGSEHEVVFKKYFEGEGLSI
    USA300_FPR3757  DGAGIMTEIPFAFFKQHVTDFDIPGEGEYAVGLFFSKERILGSEHEVVFKKYFEGEGLSI
                    **********************************************.*************

    COL             LGYRNVPVNKDAIAKHVADTMPVIQQVFIDIRDIEDVEKRLFLARKQLEFYSTQCDLELY
    N315            LGYRNVPVNKDAIAKHVADTMPVIQQVFIDIRGIEDVEKRLFLARKQLEFYSTQCDLELY
    NCTC8325        LGYRNVPVNKDAIAKHVADTMPVIQQVFIDIRDIEDVEKRLFLARKQLEFYSTQCDLELY
    Newman          LGYRNVPVNKDAIAKHVADTMPVIQQVFIDIRDIEDVEKRLFLARKQLEFYSTQCDLELY
    USA300_FPR3757  LGYRNVPVNKDAIAKHVADTMPVIQQVFIDIRDIEDVEKRLFLARKQLEFYSTQCDLELY
                    ********************************.***************************

    COL             FTSLSRKTIVYKGWLRSDQIKKVYTDLSDDLYQSKLGLVHSRFSTNTFPSWKRAHPNRML
    N315            FTSLSRKTIVYKGWLRSDQIKKLYTDLSDDLYQSKLGLVHSRFSTNTFPSWKRAHPNRML
    NCTC8325        FTSLSRKTIVYKGWLRSDQIKKLYTDLSDDLYQSKLGLVHSRFSTNTFPSWKRAHPNRML
    Newman          FTSLSRKTIVYKGWLRSDQIKKVYTDLSDDLYQSKLGLVHSRFSTNTFPSWKRAHPNRML
    USA300_FPR3757  FTSLSRKTIVYKGWLRSDQIKKLYTDLSDDLYQSKLGLVHSRFSTNTFPSWKRAHPNRML
                    **********************:*************************************

    COL             MHNGEINTIKGNVNWMRARQHKLIETLFGEDQHKVFQIVDEDGSDSAIVDNALEFLSLAM
    N315            MHNGEINTIKGNVNWMRARQHKLIETLFGEDQHKVFQIVDEDGSDSAIVDNALEFLSLAM
    NCTC8325        MHNGEINTIKGNVNWMRARQHKLIETLFGEDQHKVFQIVDEDGSDSAIVDNALEFLSLAM
    Newman          MHNGEINTIKGNVNWMRARQHKLIETLFGEDQHKVFQIVDEDGSDSAIVDNALEFLSLAM
    USA300_FPR3757  MHNGEINTIKGNVNWMRARQHKLIETLFGEDQHKVFQIVDEDGSDSAIVDNALEFLSLAM
                    ************************************************************

    COL             EPEKAAMLLIPEPWLYNEANDANVRAFYEFYSYLMEPWDGPTMISFCNGDKLGALTDRNG
    N315            EPEKAAMLLIPEPWLYNEANDANVRAFYEFYSYLMEPWDGPTMISFCNGDKLGALTDRNG
    NCTC8325        EPEKAAMLLIPEPWLYNEANDANVRAFYEFYSYLMEPWDGPTMISFCNGDKLGALTDRNG
    Newman          EPEKAAMLLIPEPWLYNEANDANVRAFYEFYSYLMEPWDGPTMISFCNGDKLGALTDRNG
    USA300_FPR3757  EPEKAAMLLIPEPWLYNEANDANVRAFYEFYSYLMEPWDGPTMISFCNGDKLGALTDRNG
                    ************************************************************

    COL             LRPGRYTITKDNFIVFSSEVGVVDVPESNVAFKGQLNPGKLLLVDFKQNKVIENNDLKGA
    N315            LRPGRYTITKDNFIVFSSEVGVVDVPESNVAFKGQLNPGKLLLVDFKQNKVIENNDLKGA
    NCTC8325        LRPGRYTITKDNFIVFSSEVGVVDVPESNVAFKGQLNPGKLLLVDFKQNKVIENNDLKGA
    Newman          LRPGRYTITKDNFIVFSSEVGVVDVPESNVAFKGQLNPGKLLLVDFKQNKVIENNDLKGA
    USA300_FPR3757  LRPGRYTITKDNFIVFSSEVGVVDVPESNVAFKGQLNPGKLLLVDFKQNKVIENNDLKGA
                    ************************************************************

    COL             IAGELPYKAWIDNHKVDFDFENIQYQDSQWKDETLFKLQRQFAYTKEEIHKYIQELVEGK
    N315            IAGELPYKAWIDNHKVDFDFENIQYQDSQWKDETLFKLQRQFAYTKEEIHKYIQELVEGK
    NCTC8325        IAGELPYKAWIDNHKVDFDFENIQYQDSQWKDETLFKLQRQFAYTKEEIHKYIQELVEGK
    Newman          IAGELPYKAWIDNHKVDFDFENIQYQDSQWKDETLFKLQRQFAYTKEEIHKYIQELVEGK
    USA300_FPR3757  IAGELPYKAWIDNHKVDFDFENIQYQDSQWKDETLFKLQRQFAYTKEEIHKYIQELVEGK
                    ************************************************************

    COL             KDPIGAMGYDAPIAVLNERPESLFNYFKQLFAQVTNPPIDAYREKIVTSELSYLGGEGNL
    N315            KDPIGAMGYDAPIAVLNERPESLFNYFKQLFAQVTNPPIDAYREKIVTSELSYLGGEGNL
    NCTC8325        KDPIGAMGYDAPIAVLNERPESLFNYFKQLFAQVTNPPIDAYREKIVTSELSYLGGEGNL
    Newman          KDPIGAMGYDAPIAVLNERPESLFNYFKQLFAQVTNPPIDAYREKIVTSELSYLGGEGNL
    USA300_FPR3757  KDPIGAMGYDAPIAVLNERPESLFNYFKQLFAQVTNPPIDAYREKIVTSELSYLGGEGNL
                    ************************************************************

    COL             LAPDETVLDRIQLKRPVLNESHLAAIDQEHFKLTYLSTVYEGDLEDALEALGREAVNAVK
    N315            LAPDETVLDRIQLKRPVLNESHLAAIDQEHFKLTYLSTVYEGDLEDALEALGREAVNAVK
    NCTC8325        LAPDETVLDRIQLKRPVLNESHLAAIDQEHFKLTYLSTVYEGDLEDALEALGREAVNAVK
    Newman          LAPDETVLDRIQLKRPVLNESHLAAIDQEHFKLTYLSTVYEGDLEDALEALGREAVNAVK
    USA300_FPR3757  LAPDETVLDRIQLKRPVLNESHLAAIDQEHFKLTYLSTVYEGDLEDALEALGREAVNAVK
                    ************************************************************

    COL             QGAQILVLDDSGLVDSNGFAMPMLLAISHVHQLLIKADLRMSTSLVAKSGETREVHHVAC
    N315            QGAQILVLDDSGLVDSNGFAMPMLLAISHVHQLLIKADLRMSTSLVAKSGETREVHHVAC
    NCTC8325        QGAQILVLDDSGLVDSNGFAMPMLLAISHVHQLLIKADLRMSTSLVAKSGETREVHHVAC
    Newman          QGAQILVLDDSGLVDSNGFAMPMLLAISHVHQLLIKADLRMSTSLVAKSGETREVHHVAC
    USA300_FPR3757  QGAQILVLDDSGLVDSNGFAMPMLLAISHVHQLLIKADLRMSTSLVAKSGETREVHHVAC
                    ************************************************************

    COL             LLAYGANAIVPYLAQRTVEQLTLTEGLQGTVVDNVKTYTDVLSEGVIKVMAKMGISTVQS
    N315            LLAYGANAIVPYLAQRTVEQLTLTEGLQGTVVDNVKTYTDVLSEGVIKVMAKMGISTVQS
    NCTC8325        LLAYGANAIVPYLAQRTVEQLTLTEGLQGTVVDNVKTYTDVLSEGVIKVMAKMGISTVQS
    Newman          LLAYGANAIVPYLAQRTVEQLTLTEGLQGTVVDNVKTYTDVLSEGVIKVMAKMGISTVQS
    USA300_FPR3757  LLAYGANAIVPYLAQRTVEQLTLTEGLQGTVVDNVKTYTDVLSEGVIKVMAKMGISTVQS
                    ************************************************************

    COL             YQGAQIFEAIGLSHDVIDRYFTGTQSKLSGISIDQIDAENKARQQSDDNYLASGSTFQWR
    N315            YQGAQIFEAIGLSHDVIDRYFTGTQSKLSGISIDQIDAENKARQQSDDNYLASGSTFQWR
    NCTC8325        YQGAQIFEAIGLSHDVIDRYFTGTQSKLSGISIDQIDAENKARQQSDDNYLASGSTFQWR
    Newman          YQGAQIFEAIGLSHDVIDRYFTGTQSKLSGISIDQIDAENKARQQSDDNYLASGSTFQWR
    USA300_FPR3757  YQGAQIFEAIGLSHDVIDRYFTGTQSKLSGISIDQIDAENKARQQSDDNYLASGSTFQWR
                    ************************************************************

    COL             QQGQHHAFNPESIFLLQHACKENDYAQFKAYSEAVNKNRTDHIRHLLEFKACTPIDIDQV
    N315            QQGQHHAFNPESIFLLQHACKENDYAQFKAYSEAVNKNRTDHIRHLLEFKACTPIDIDQV
    NCTC8325        QQGQHHAFNPESIFLLQHACKENDYAQFKAYSEAVNKNRTDHIRHLLEFKACTPIDIDQV
    Newman          QQGQHHAFNPESIFLLQHACKENDYAQFKAYSEAVNKNRTDHIRHLLEFKACTPIDIDQV
    USA300_FPR3757  QQGQHHAFNPESIFLLQHACKENDYAQFKAYSEAVNKNRTDHIRHLLEFKACTPIDIDQV
                    ************************************************************

    COL             EPVSDIVKRFNTGAMSYGSISAEAHETLAQAMNQLGGKSNSGEGGEDAKRYEVQVDGSNK
    N315            EPVSDIVKRFNTGAMSYGSISAEAHETLAQAMNQLGGKSNSGEGGEDAKRYEVQVDGSNK
    NCTC8325        EPVSDIVKRFNTGAMSYGSISAEAHETLAQAMNQLGGKSNSGEGGEDAKRYEVQVDGSNK
    Newman          EPVSDIVKRFNTGAMSYGSISAEAHETLAQAMNQLGGKSNSGEGGEDAKRYEVQVDGSNK
    USA300_FPR3757  EPVSDIVKRFNTGAMSYGSISAEAHETLAQAMNQLGGKSNSGEGGEDAKRYEVQVDGSNK
                    ************************************************************

    COL             VSAIKQVASGRFGVTSDYLQHAKEIQIKVAQGAKPGEGGQLPGTKVYPWIAKTRGSTPGI
    N315            VSAIKQVASGRFGVTSDYLQHAKEIQIKVAQGAKPGEGGQLPGTKVYPWIAKTRGSTPGI
    NCTC8325        VSAIKQVASGRFGVTSDYLQHAKEIQIKVAQGAKPGEGGQLPGTKVYPWIAKTRGSTPGI
    Newman          VSAIKQVASGRFGVTSDYLQHAKEIQIKVAQGAKPGEGGQLPGTKVYPWIAKTRGSTPGI
    USA300_FPR3757  VSAIKQVASGRFGVTSDYLQHAKEIQIKVAQGAKPGEGGQLPGTKVYPWIAKTRGSTPGI
                    ************************************************************

    COL             GLISPPPHHDIYSIEDLAQLIHDLKNANKDADIAVKLVSKTGVGTIASGVAKAFADKIVI
    N315            GLISPPPHHDIYSIEDLAQLIHDLKNANKDADIAVKLVSKTGVGTIASGVAKAFADKIVI
    NCTC8325        GLISPPPHHDIYSIEDLAQLIHDLKNANKDADIAVKLVSKTGVGTIASGVAKAFADKIVI
    Newman          GLISPPPHHDIYSIEDLAQLIHDLKNANKDADIAVKLVSKTGVGTIASGVAKAFADKIVI
    USA300_FPR3757  GLISPPPHHDIYSIEDLAQLIHDLKNANKDADIAVKLVSKTGVGTIASGVAKAFADKIVI
                    ************************************************************

    COL             SGYDGGTGASPKTSIQHAGVPWEIGLAETHQTLKLNDLRSRVKLETDGKLLTGKDVAYAC
    N315            SGYDGGTGASPKTSIQHAGVPWEIGLAETHQTLKLNDLRSRVKLETDGKLLTGKDVAYAC
    NCTC8325        SGYDGGTGASPKTSIQHAGVPWEIGLAETHQTLKLNDLRSRVKLETDGKLLTGKDVAYAC
    Newman          SGYDGGTGASPKTSIQHAGVPWEIGLAETHQTLKLNDLRSRVKLETDGKLLTGKDVAYAC
    USA300_FPR3757  SGYDGGTGASPKTSIQHAGVPWEIGLAETHQTLKLNDLRSRVKLETDGKLLTGKDVAYAC
                    ************************************************************

    COL             ALGAEEFGFATAPLVVLGCIMMRVCHKDTCPVGVATQNKDLRALYRGKAHHVVNFMHFIA
    N315            ALGAEEFGFATAPLVVLGCIMMRVCHKDTCPVGVATQNKDLRALYRGKAHHVVNFMHFIA
    NCTC8325        ALGAEEFGFATAPLVVLGCIMMRVCHKDTCPVGVATQNKDLRALYRGKAHHVVNFMHFIA
    Newman          ALGAEEFGFATAPLVVLGCIMMRVCHKDTCPVGVATQNKDLRALYRGKAHHVVNFMHFIA
    USA300_FPR3757  ALGAEEFGFATAPLVVLGCIMMRVCHKDTCPVGVATQNKDLRALYRGKAHHVVNFMHFIA
                    ************************************************************

    COL             QELREILASLGLKRVEDLVGRTDLLQRSSTLKANSKAASIDVEKLLCPFDGPNTKEIQQN
    N315            QELREILASLGLKRVEDLVGRTDLLQRSSTLKANSKVASIDVEKLLCPFDGPNTKEIQQN
    NCTC8325        QELREILASLGLKRVEDLVGRTDLLQRSSTLKANSKAASIDVEKLLCPFDGPNTKEIQQN
    Newman          QELREILASLGLKRVEDLVGRTDLLQRSSTLKANSKAASIDVEKLLCPFDGPNTKEIQQN
    USA300_FPR3757  QELREILASLGLKRVEDLVGRTDLLQRSSTLKANSKAASIDVEKLLCPFDGPNTKEIQQN
                    ************************************.***********************

    COL             HNLEHGFDLTNLYEVTKPYIAEGRRYTGSFTVNNEQRDVGVITGSEISKQYGEAGLPENT
    N315            HNLEHGFDLTNLYEVTKPYIAEGRRYTGSFTVNNEQRDVGVITGSEISKQYGEAGLPENT
    NCTC8325        HNLEHGFDLTNLYEVTKPYIAEGRRYTGSFTVNNEQRDVGVITGSEISKQYGEAGLPENT
    Newman          HNLEHGFDLTNLYEVTKPYIAEGRRYTGSFTVNNEQRDVGVITGSEISKQYGEAGLPENT
    USA300_FPR3757  HNLEHGFDLTNLYEVTKPYIAEGRRYTGSFTVNNEQRDVGVITGSEISKQYGEAGLPENT
                    ************************************************************

    COL             INVYTNGHAGQSLAAYAPKGLMIHHTGDANDYVGKGLSGGTVIVKAPFEERQNEIIAGNV
    N315            INVYTNGHAGQSLAAYAPKGLMIHHTGDANDYVGKGLSGGTVIVKAPFEERQNEIIAGNV
    NCTC8325        INVYTNGHAGQSLAAYAPKGLMIHHTGDANDYVGKGLSGGTVIVKAPFEERQNEIIAGNV
    Newman          INVYTNGHAGQSLAAYAPKGLMIHHTGDANDYVGKGLSGGTVIVKAPFEERQNEIIAGNV
    USA300_FPR3757  INVYTNGHAGQSLAAYAPKGLMIHHTGDANDYVGKGLSGGTVIVKAPFEERQNEIIAGNV
                    ************************************************************

    COL             SFYGATSGKAFINGSAGERFCIRNSGVDVVVEGIGDHGLEYMTGGHVINLGDVGKNFGQG
    N315            SFYGATGGKAFINGSAGERFCIRNSGVDVVVEGIGDHGLEYMTGGHVINLGDVGKNFGQG
    NCTC8325        SFYGATSGKAFINGSAGERFCIRNSGVDVVVEGIGDHGLEYMTGGHVINLGDVGKNFGQG
    Newman          SFYGATSGKAFINGSAGERFCIRNSGVDVVVEGIGDHGLEYMTGGHVINLGDVGKNFGQG
    USA300_FPR3757  SFYGATSGKAFINGSAGERFCIRNSGVDVVVEGIGDHGLEYMTGGHVINLGDVGKNFGQG
                    ******.*****************************************************

    COL             MSGGIAYVIPSDVEAFVENNQLDTLSFTKIKHQEEKAFIKQMLEEHVSHTNSTRAIHVLK
    N315            MSGGIAYVIPSDVEAFVENNQLDTLSFTKIKHQEEKAFIKQMLEEHVSHTNSTRAIHVLK
    NCTC8325        MSGGIAYVIPSDVEAFVENNQLDTLSFTKIKHQEEKAFIKQMLEEHVSHTNSTRAIHVLK
    Newman          MSGGIAYVIPSDVEAFVENNQLDTLSFTKIKHQEEKAFIKQMLEEHVSHTNSTRAIHVLK
    USA300_FPR3757  MSGGIAYVIPSDVEAFVENNQLDTLSFTKIKHQEEKAFIKQMLEEHVSHTNSTRAIHVLK
                    ************************************************************

    COL             HFDRIEDVVVKVIPKDYQLMMQKIHLHKSLHDNEDEAMLAAFYDDSKTIDAKHKPAVVY
    N315            HFDRIEDVVVKVIPKDYQLMMQKIHLHKSLHDNEDEAMLAAFYDDSKTIDAKHKPAVVY
    NCTC8325        HFDRIEDVVVKVIPKDYQLMMQKIHLHKSLHDNEDEAMLAAFYDDSKTIDAKHKPAVVY
    Newman          HFDRIEDVVVKVIPKDYQLMMQKIHLHKSLHDNEDEAMLAAFYDDSKTIDAKHKPAVVY
    USA300_FPR3757  HFDRIEDVVVKVIPKDYQLMMQKIHLHKSLHDNEDEAMLAAFYDDSKTIDAKHKPAVVY
                    ***********************************************************