From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002197000
  • symbol?:
  • description?: acetyltransferase

      descriptions from strain specific annotations:

    • acetyltransferase
    • N-acetyltransferase GCN5
    • acetyltransferase, GNAT family protein
    • GNAT family acetyltransferase
    • Acetyltransferase (GNAT) family protein
    • acetyltransferase family protein
  • strand?: +
  • coordinates?: 2702404..2702928
  • synteny block?: BlockID0014980
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0452
    08BA02176:
    C248_0528
    11819-97:
    MS7_0451
    71193:
    ST398NM01_0543
    ECT-R 2:
    ECTR2_412
    ED133:
    SAOV_0495
    ED98:
    SAAV_0421
    HO 5096 0412:
    SAEMRSA15_04030
    JH1:
    SaurJH1_0511
    JH9:
    SaurJH9_0498
    JKD6008:
    SAA6008_00481
    JKD6159:
    SAA6159_00426
    LGA251:
    SARLGA251_04100
    M013:
    M013TW_0442
    MRSA252:
    SAR0476
    MSHR1132:
    SAMSHR1132_04210
    MSSA476:
    SAS0434
    Mu3:
    SAHV_0474
    Mu50:
    SAV0477
    MW2:
    MW0432
    RF122:
    SAB0426
    ST398:
    SAPIG0543
    T0131:
    SAT0131_00518 (rot)
    TCH60:
    HMPREF0772_10045
    TW20:
    SATW20_05450
    USA300_TCH1516:
    USA300HOU_0476
    VC40:
    SAVC_01970

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQIYLSTLTELDYDKSLNSIEESFDDNPETSWQARAKVKHLRKSPCYNFELEVIAKNENN
    N315            MQIYLSTLTELDYDKSLNSIEESFDDNPETSWQARAKVKHLRKSPCYNFELEVIAKNENN
    NCTC8325        MQIYLSTLTELDYDKSLNSIEESFDDNPETSWQARAKVKHLRKSPCYNFELEVIAKNENN
    Newman          MQIYLSTLTELDYDKSLNSIEESFDDNPETSWQARAKVKHLRKSPCYNFELEVIAKNENN
    USA300_FPR3757  MQIYLSTLTELDYDKSLNSIEESFDDNPETSWQARAKVKHLRKSPCYNFELEVIAKNENN
                    ************************************************************

    COL             DVVGHVLLIEVEINSDDKTYYGLAIASLSVHPELRGQKLGRGLVQAVEERAKAQEYSTVV
    N315            DVVGHVLLIEVEINSDDKTYYGLAIASLSVHPELRGQKLGRGLVQAVEERAKAQEYSTVV
    NCTC8325        DVVGHVLLIEVEINSDDKTYYGLAIASLSVHPELRGQKLGRGLVQAVEERAKAQEYSTVV
    Newman          DVVGHVLLIEVEINSDDKTYYGLAIASLSVHPELRGQKLGRGLVQAVEERAKAQEYSTVV
    USA300_FPR3757  DVVGHVLLIEVEINSDDKTYYGLAIASLSVHPELRGQKLGRGLVQAVEERAKAQEYSTVV
                    ************************************************************

    COL             VDHCFDYFEKLGYQNAAEHDIKLEFGDAPLLVKYLWDNLTDAPHGIVKFPEHFY
    N315            VDHCFDYFEKLGYQNAAEHDIKLESGDAPLLVKYLWDNLTDAPHGIVKFPEHFY
    NCTC8325        VDHCFDYFEKLGYQNAAEHDIKLESGDAPLLVKYLWDNLTDAPHGIVKFPEHFY
    Newman          VDHCFDYFEKLGYQNAAEHDIKLESGDAPLLVKYLWDNLTDAPHGIVKFPEHFY
    USA300_FPR3757  VDHCFDYFEKLGYQNAAEHDIKLESGDAPLLVKYLWDNLTDAPHGIVKFPEHFY
                    ************************ *****************************