From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002216000
  • symbol?: tmk
  • description?: thymidylate kinase

      descriptions from strain specific annotations:

    • thymidylate kinase
    • putative thymidylate kinase
  • strand?: +
  • coordinates?: 2730702..2731334
  • synteny block?: BlockID0015150
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0524 (tmk)
    N315:
    SA0440 (tmk)
    NCTC8325:
    Newman:
    NWMN_0446 (tmk)
    USA300_FPR3757:
    04-02981:
    SA2981_0457
    08BA02176:
    C248_0536 (tmk)
    11819-97:
    MS7_0459 (tmk)
    71193:
    ST398NM01_0548
    ECT-R 2:
    ECTR2_422 (tmk)
    ED133:
    SAOV_0503
    ED98:
    SAAV_0428 (tmk)
    HO 5096 0412:
    SAEMRSA15_04080 (tmk)
    JH1:
    SaurJH1_0516 (tmk)
    JH9:
    SaurJH9_0503 (tmk)
    JKD6008:
    SAA6008_00486 (tmk)
    JKD6159:
    SAA6159_00433 (tmk)
    LGA251:
    SARLGA251_04160 (tmk)
    M013:
    M013TW_0451
    MRSA252:
    SAR0483 (tmk)
    MSHR1132:
    SAMSHR1132_04260
    MSSA476:
    SAS0439 (tmk)
    Mu3:
    SAHV_0479 (tmk)
    Mu50:
    SAV0482 (tmk)
    MW2:
    MW0437 (tmk)
    RF122:
    SAB0431 (tmk)
    ST398:
    SAPIG0548 (tmk)
    T0131:
    SAT0131_00525 (ribH)
    TCH60:
    HMPREF0772_10039 (tmk)
    TW20:
    SATW20_05500 (tmk)
    USA300_TCH1516:
    USA300HOU_0481 (tmk)
    VC40:
    SAVC_01995 (tmk)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----MSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGN
    N315            -----MSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGN
    NCTC8325        -----MSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGN
    Newman          MRMNKMSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGN
    USA300_FPR3757  -----MSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGN
                         *******************************************************

    COL             DMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRAL
    N315            DMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRAL
    NCTC8325        DMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRAL
    Newman          DMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRAL
    USA300_FPR3757  DMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRAL
                    ************************************************************

    COL             NEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES
    N315            NEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES
    NCTC8325        NEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES
    Newman          NEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES
    USA300_FPR3757  NEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES
                    ************************************************************

    COL             QRFKSVNADQPLENVVEDTYQTIIKYLEKI
    N315            QRFKSVNADQPLENVVEDTYQTIIKYLEKI
    NCTC8325        QRFKSVNADQPLENVVEDTYQTIIKYLEKI
    Newman          QRFKSVNADQPLENVVEDTYQTIIKYLEKI
    USA300_FPR3757  QRFKSVNADQPLENVVEDTYQTIIKYLEKI
                    ******************************