From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002224000
  • symbol?:
  • description?: excinuclease ABC subunit C

      descriptions from strain specific annotations:

    • excinuclease ABC subunit C
    • putative endonuclease containing a URIdomain
    • endo/excinuclease domain protein
    • putative GIY-YIG nuclease
    • endo/exonuclease amino terminal GIY-YIG domain protein
    • GIY-YIG catalytic domain-containing protein
  • strand?: +
  • coordinates?: 2735013..2735261
  • synteny block?: BlockID0015230
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0463
    08BA02176:
    C248_0542
    11819-97:
    MS7_0465
    71193:
    ST398NM01_0554
    ECT-R 2:
    ECTR2_428
    ED133:
    SAOV_0509
    ED98:
    SAAV_0434
    HO 5096 0412:
    SAEMRSA15_04140
    JH1:
    SaurJH1_0522
    JH9:
    SaurJH9_0509
    JKD6008:
    SAA6008_00492
    JKD6159:
    SAA6159_00439
    LGA251:
    SARLGA251_04220
    M013:
    M013TW_0457
    MRSA252:
    SAR0489
    MSHR1132:
    SAMSHR1132_04320
    MSSA476:
    SAS0445
    Mu3:
    SAHV_0485
    Mu50:
    SAV0488
    MW2:
    MW0443
    RF122:
    SAB0437
    ST398:
    SAPIG0554
    T0131:
    SAT0131_00533 (arsC)
    TCH60:
    HMPREF0772_10033
    TW20:
    SATW20_05560
    USA300_TCH1516:
    USA300HOU_0488
    VC40:
    SAVC_02025

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDSHFVYIVKCSDGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEA
    N315            MDSHFVYIVKCSDGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEA
    NCTC8325        MDSHFVYIVKCSDGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEA
    USA300_FPR3757  MDSHFVYIVKCSDGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEA
                    ************************************************************

    COL             LKREYEIKTYTRQKKLRLIKER
    N315            LKREYEIKTYTRQKKLRLIKER
    NCTC8325        LKREYEIKTYTRQKKLRLIKER
    USA300_FPR3757  LKREYEIKTYTRQKKLRLIKER
                    **********************