From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002229000
  • symbol?: rnmV
  • description?: ribonuclease M5

      descriptions from strain specific annotations:

    • ribonuclease M5
    • primase-like protein
    • putative primase homolog
    • RNAse M5
    • toprim domain-containing protein
  • strand?: +
  • coordinates?: 2739341..2739638
  • synteny block?: BlockID0015280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0467
    08BA02176:
    C248_0547
    11819-97:
    MS7_0469 (rnmV)
    71193:
    ST398NM01_0558
    ECT-R 2:
    ECTR2_432
    ED133:
    SAOV_0514
    ED98:
    SAAV_0439
    HO 5096 0412:
    SAEMRSA15_04180
    JH1:
    SaurJH1_0526
    JH9:
    SaurJH9_0513
    JKD6008:
    SAA6008_00496
    JKD6159:
    SAA6159_00443
    LGA251:
    SARLGA251_04260
    M013:
    M013TW_0462
    MRSA252:
    SAR0493
    MSHR1132:
    SAMSHR1132_04360
    MSSA476:
    SAS0449
    Mu3:
    SAHV_0489
    Mu50:
    SAV0492
    MW2:
    MW0447
    RF122:
    SAB0441
    ST398:
    SAPIG0558
    T0131:
    SAT0131_00537
    TCH60:
    HMPREF0772_10028
    TW20:
    SATW20_05600
    USA300_TCH1516:
    USA300HOU_0492
    VC40:
    SAVC_02045

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKINEFIVVEGRDDTERVKRAVECDTIETNGSAINEQTLEVIRNAQQSRGVIVLTDPDFP
    N315            MKINEFIVVEGRDDTERVKRAVECDTIETNGSAINEQTLEVIRNAQQSRGVIVLTDPDFP
    NCTC8325        MKINEFIVVEGRDDTERVKRAVECDTIETNGSAINEQTLEVIRNAQQSRGVIVLTDPDFP
    Newman          MKINEFIVVEGRDDTERVKRAVECDTIETNGSAINEQTLEVIRNAQQSRGVIVLTDPDFP
    USA300_FPR3757  MKINEFIVVEGRDDTERVKRAVECDTIETNGSAINEQTLEVIRNAQQSRGVIVLTDPDFP
                    ************************************************************

    COL             GDKIRSTITEHVKGVKHAYIDREKAKNKKGKIGVEHADLIDIKEALMHVSSPFDEAYESI
    N315            GDKIRSTITEHVKGVKHAYIDREKAKNKKGKIGVEHADLIDIKEALMHVSSPFDEAYESI
    NCTC8325        GDKIRSTITEHVKGVKHAYIDREKAKNKKGKIGVEHADLIDIKEALMHVSSPFDEAYESI
    Newman          GDKIRSTITEHVKGVKHAYIDREKAKNKKGKIGVEHADLIDIKEALMHVSSPFDEAYESI
    USA300_FPR3757  GDKIRSTITEHVKGVKHAYIDREKAKNKKGKIGVEHAELIDIKEALMHVSSPFDEAYESI
                    *************************************:**********************

    COL             DKSVLIELGLIVGKDARRRREILSRKLRIGHSNGKQLLKKLNAFGYTEADVRQALEDE
    N315            DKSVLIELGLIVGKDARRRREILSRKLRIGHSNGKQLLKKLNAFGYTEADVRQALEDE
    NCTC8325        DKSVLIELGLIVGKDARRRREILSRKLRIGHSNGKQLLKKLNAFGYTEADVRQALEDE
    Newman          DKSVLIELGLIVGKDARRRREILSRKLRIGHSNGKQLLKKLNAFGYTEADVRQALEDE
    USA300_FPR3757  DKSVLIELGLIVGKDARRRREILSRKLRIGHSNGKQLLKKLNAFGYTEADVRQALEDE
                    **********************************************************