From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002232000
  • symbol?: veg
  • description?: Veg protein

      descriptions from strain specific annotations:

    • Veg protein
    • protein veg
  • strand?: +
  • coordinates?: 2740881..2741144
  • synteny block?: BlockID0015310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0452 (veg)
    NCTC8325:
    Newman:
    NWMN_0457 (veg)
    USA300_FPR3757:
    04-02981:
    SA2981_0469 (veg)
    08BA02176:
    C248_0549
    11819-97:
    MS7_0471
    71193:
    ST398NM01_0560
    ECT-R 2:
    ECTR2_434
    ED133:
    SAOV_0516
    ED98:
    SAAV_0441
    HO 5096 0412:
    SAEMRSA15_04200 (veg)
    JH1:
    SaurJH1_0528
    JH9:
    SaurJH9_0515
    JKD6008:
    SAA6008_00498
    JKD6159:
    SAA6159_00445
    LGA251:
    SARLGA251_04280 (veg)
    M013:
    M013TW_0465
    MRSA252:
    SAR0495 (veg)
    MSHR1132:
    SAMSHR1132_04380
    MSSA476:
    SAS0451
    Mu3:
    SAHV_0491 (veg)
    Mu50:
    SAV0494 (veg)
    MW2:
    MW0449 (veg)
    RF122:
    SAB0443
    ST398:
    SAPIG0560
    T0131:
    SAT0131_00539
    TCH60:
    HMPREF0772_10026 (veg)
    TW20:
    SATW20_05620 (veg)
    USA300_TCH1516:
    USA300HOU_0494
    VC40:
    SAVC_02055

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPKSILDIKNSIDCHVGNRIVLKANGGRKKTIKRSGILKETYPSVFIVELDQDKHNFERV
    N315            MPKSILDIKNSIDCHVGNRIVLKANGGRKKTIKRSGILKETYPSVFIVELDQDKHNFERV
    NCTC8325        MPKSILDIKNSIDCHVGNRIVLKANGGRKKTIKRSGILKETYPSVFIVELDQDKHNFERV
    Newman          MPKSILDIKNSIDCHVGNRIVLKANGGRKKTIKRSGILKETYPSVFIVELDQDKHNFERV
    USA300_FPR3757  MPKSILDIKNSIDCHVGNRIVLKANGGRKKTIKRSGILKETYPSVFIVELDQDKHNFERV
                    ************************************************************

    COL             SYTYTDVLTENVQVSFEEDNHHESIAH
    N315            SYTYTDVLTENVQVSFEEDNHHESIAH
    NCTC8325        SYTYTDVLTENVQVSFEEDNHHESIAH
    Newman          SYTYTDVLTENVQVSFEEDNHHESIAH
    USA300_FPR3757  SYTYTDVLTENVQVSFEEDNHHESIAH
                    ***************************