From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002235000
  • symbol?: yabJ
  • description?: RidA family protein

      descriptions from strain specific annotations:

    • RidA family protein
    • endoribonuclease L-PSP
    • putative endoribonuclease L-PSP
    • endoribonuclease L-PSP, putative
    • putative regulatory protein
    • rutC family protein yabJ
    • translation initiation inhibitor homologue
    • translation initiation inhibitor-like protein
    • YabJ, a purine regulatory protein
  • strand?: +
  • coordinates?: 2743162..2743542
  • synteny block?: BlockID0015340
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0472
    08BA02176:
    C248_0552 (yabJ)
    11819-97:
    MS7_0474 (yabJ)
    71193:
    ST398NM01_0563
    ECT-R 2:
    ECTR2_437
    ED133:
    SAOV_0519
    ED98:
    SAAV_0444
    HO 5096 0412:
    SAEMRSA15_04230 (yabJ)
    JH1:
    SaurJH1_0531
    JH9:
    SaurJH9_0518
    JKD6008:
    SAA6008_00501
    JKD6159:
    SAA6159_00448
    LGA251:
    SARLGA251_04310 (yabJ)
    M013:
    M013TW_0468
    MRSA252:
    SAR0498 (yabJ)
    MSHR1132:
    SAMSHR1132_04410
    MSSA476:
    SAS0454
    Mu3:
    SAHV_0494
    Mu50:
    SAV0497
    MW2:
    MW0452
    RF122:
    SAB0446 (yabJ)
    ST398:
    SAPIG0563
    T0131:
    SAT0131_00542
    TCH60:
    HMPREF0772_10023
    TW20:
    SATW20_05650 (yabJ)
    USA300_TCH1516:
    VC40:
    SAVC_02070

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIINTTRLPEALGPYSHATVVNGMVYTSGQIPLNIDGHIVSADVQAQTKQVLENLKVVL
    N315            MKIINTTRLPEALGPYSHATVVNGMVYTSGQIPLNVDGKIVSADVQAQTKQVLENLKVVL
    NCTC8325        MKIINTTRLPEALGPYSHATVVNGMVYTSGQIPLNIDGHIVSADVQAQTKQVLENLKVVL
    Newman          MKIINTTRLPEALGPYSHATVVNGMVYTSGQIPLNIDGHIVSADVQAQTKQVLENLKVVL
    USA300_FPR3757  MKIINTTRLPEALGPYSHATVVNGMVYTSGQIPLNIDGHIVSADVQAQTKQVLENLKVVL
                    ***********************************:**:*********************

    COL             EEAGSDLNSVAKATIFIKDMNDFQKINEVYGQYFNEHKPARSCVEVARLPKDVKVEIELV
    N315            EEAGSDLNSVAKATIFIKDMNDFQKINEVYGQYFNEHKPARSCVEVARLPKDVKVEIELV
    NCTC8325        EEAGSDLNSVAKATIFIKDMNDFQKINEVYGQYFNEHKPARSCVEVARLPKDVKVEIELV
    Newman          EEAGSDLNSVAKATIFIKDMNDFQKINEVYGQYFNEHKPARSCVEVARLPKDVKVEIELV
    USA300_FPR3757  EEAGSDLNSVAKATIFIKDMNDFQKINEVYGQYFNEHKPARSCVEVARLPKDVKVEIELV
                    ************************************************************

    COL             SKIKEL
    N315            SKIKEL
    NCTC8325        SKIKEL
    Newman          SKIKEL
    USA300_FPR3757  SKIKEL
                    ******