Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002245000
  • symbol?:
  • description?: low temperature requirement B protein

      descriptions from strain specific annotations:

    • low temperature requirement B protein
    • polysaccharide biosynthesis protein
    • mviN-like family protein
    • polysaccharide biosynthesis family protein
    • putative polysaccharide biosynthesis protein
    • MOP superfamily PST family polysaccharide transporter
    • export protein for polysaccharides and teichoic acids
    • Stage V sporulation protein B
    • membrane spanning protein
  • strand?: +
  • coordinates?: 2753027..2754556
  • synteny block?: BlockID0015440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0479
    08BA02176:
    C248_0560
    11819-97:
    MS7_0481
    71193:
    ST398NM01_0570
    ECT-R 2:
    ECTR2_444
    ED133:
    SAOV_0526
    ED98:
    SAAV_0451
    HO 5096 0412:
    SAEMRSA15_04300
    JH1:
    SaurJH1_0539
    JH9:
    SaurJH9_0526
    JKD6008:
    SAA6008_00509
    JKD6159:
    SAA6159_00455
    LGA251:
    SARLGA251_04380
    M013:
    M013TW_0476
    MRSA252:
    SAR0505
    MSHR1132:
    SAMSHR1132_04480
    MSSA476:
    SAS0461
    Mu3:
    SAHV_0501
    Mu50:
    SAV0504
    MW2:
    MW0459
    RF122:
    SAB0453
    ST398:
    SAPIG0570
    T0131:
    SAT0131_00550
    TCH60:
    HMPREF0772_10015
    TW20:
    SATW20_05720
    USA300_TCH1516:
    USA300HOU_0498
    VC40:
    SAVC_02105

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKHKEAFNGVVVLTAALIVIKILSAVYRIPYQNILGDTGLYAYQQVYPIVALGMILSMNA
    N315            MKHKEAFNGVVVLTAALIVIKILSAVYRIPYQNILGDTGLYAYQQVYPIVALGMILSMNA
    NCTC8325        MKHKEAFNGVVVLTAALIVIKILSAVYRIPYQNILGDTGLYAYQQVYPIVALGMILSMNA
    Newman          MKHKEAFNGVVVLTAALIVIKILSAVYRIPYQNILGDTGLYAYQQVYPIVALGMILSMNA
    USA300_FPR3757  MKHKEAFNGVVVLTAALIVIKILSAVYRIPYQNILGDTGLYAYQQVYPIVALGMILSMNA
                    ************************************************************

    COL             IPSAITQNIGKYHSDEAYAKAVAYIQLVGILLFIAIFVFANNIAHMMGDGHLTPMIQAAS
    N315            IPSAITQNIGKYHSDEAYAKAVAYIQLVGILLFIAIFVFANNIAHMMGDSHLTPMIQAAS
    NCTC8325        IPSAITQNIGKYHSDEAYAKAVAYIQLVGILLFIAIFVFANNIAHMMGDGHLTPMIQAAS
    Newman          IPSAITQNIGKYHSDEAYAKAVAYIQLVGILLFIAIFVFANNIAHMMGDGHLTPMIQAAS
    USA300_FPR3757  IPSAITQNIGKYHSDEAYAKAVAYIQLVGILLFIAIFVFANNIAHMMGDGHLTPMIQAAS
                    *************************************************.**********

    COL             LSFIFIGMLGVLRGYYQSANNMTVPAISQVIEQVIRVGIIIVTIVIFVDRGWTIYEAGTI
    N315            LSFIFIGMLGVLRGYYQSANNMTVPAISQVIEQVIRVGIIIVTIVIFVDRGWTIYEAGTI
    NCTC8325        LSFIFIGMLGVLRGYYQSANNMTVPAISQVIEQVIRVGIIIVTIVIFVDRGWTIYEAGTI
    Newman          LSFIFIGMLGVLRGYYQSANNMTVPAISQVIEQVIRVGIIIVTIVIFVDRGWTIYEAGTI
    USA300_FPR3757  LSFIFIGMLGVLRGYYQSANNMTVPAISQVIEQVIRVGIIIVTIVIFVDRGWTIYEAGTI
                    ************************************************************

    COL             AILASTIGFLGSSIYLVAHRPFKFKMVNNTAKIVWKQFALSVLIFAISQLIVILWQVIDS
    N315            AILASTIGFLGSSIYLVAHRPFKFKMVNNTAKIVWKQFALSVLIFAISQLIVILWQVIDS
    NCTC8325        AILASTIGFLGSSIYLVAHRPFKFKMVNNTAKIVWKQFALSVLIFAISQLIVILWQVIDS
    Newman          AILASTIGFLGSSIYLVAHRPFKFKMVNNTAKIVWKQFALSVLIFAISQLIVILWQVIDS
    USA300_FPR3757  AILASTIGFLGSSIYLVAHRPFKFKMVNNTAKIVWKQFALSVLIFAISQLIVILWQVIDS
                    ************************************************************

    COL             VTIIKSLQAIRVPFDVAITEKGVYDRGASFIQMGLIVTTTFSFALIPLLSDAIKMNNQVL
    N315            VTIIKSLQAIRVPFDVAITEKGVYDRGASFIQMGLIVTTTFSFALIPLLSDAIKMNNQVL
    NCTC8325        VTIIKSLQAIRVPFDVAITEKGVYDRGASFIQMGLIVTTTFSFALIPLLSDAIKMNNQVL
    Newman          VTIIKSLQAIRVPFDVAITEKGVYDRGASFIQMGLIVTTTFSFALIPLLSDAIKMNNQVL
    USA300_FPR3757  VTIIKSLQAIRVPFDVAITEKGVYDRGASFIQMGLIVTTTFSFALIPLLSDAIKMNNQVL
                    ************************************************************

    COL             MNRYANASLKITILISTAAGIGLINLLPLMNGVFFKTNDLTLTLSVYMITVICVSLIMMD
    N315            MNRYANASLKITILISTAAGIGLINLLPLMNGVFFKTNDLTLTLSVYMITVICVSLIMMD
    NCTC8325        MNRYANASLKITILISTAAGIGLINLLPLMNGVFFKTNDLTLTLSVYMITVICVSLIMMD
    Newman          MNRYANASLKITILISTAAGIGLINLLPLMNGVFFKTNDLTLTLSVYMITVICVSLIMMD
    USA300_FPR3757  MNRYANASLKITILISTAAGIGLINLLPLMNGVFFKTNDLTLTLSVYMITVICVSLIMMD
                    ************************************************************

    COL             MALLQAQHAVRPIFVGMTAGLVIKFILNIILIRLSGIIGASISTVVSLIIFGTIIHIAVT
    N315            MALLQAQHAVRPIFVGMTAGLVIKFILNIILIRLSGIIGASISTVVSLIIFGTIIHIAVT
    NCTC8325        MALLQAQHAVRPIFVGMTAGLVIKFILNIILIRLSGIIGASISTVVSLIIFGTIIHIAVT
    Newman          MALLQAQHAVRPIFVGMTAGLVIKFILNIILIRLSGIIGASISTVVSLIIFGTIIHIAVT
    USA300_FPR3757  MALLQAQHAVRPIFVGMTAGLVIKFILNIILIRLSGIIGASISTVVSLIIFGTIIHIAVT
                    ************************************************************

    COL             RKYHLYAMRRFFINVVLGMVFMSIVVQCVLNIVTTHGRITGLIELLCAAVLGIIALFFYI
    N315            RKYHLHAMRRFFINVVLGMVFMSIVVQCVLNIVTTHGRFTGLIELLCAAVLGIIALFFYI
    NCTC8325        RKYHLYAMRRFFINVVLGMVFMSIVVQCVLNIVTTHGRITGLIELLCAAVLGIIALFFYI
    Newman          RKYHLYAMRRFFINVVLGMVFMSIVVQCVLNIVTTHGRITGLIELLCAAVLGIIALFFYI
    USA300_FPR3757  RKYHLYAMRRFFINVVLGMVFMSIVVQCVLNIVTTHGRITGLIELLCAAVLGIIALFFYI
                    *****:********************************:*********************

    COL             FRFNVLTYKELTYLPFGSKLYQIKKGRR
    N315            FRFNVLTYKELTYLPFGSKLYQIKKGRR
    NCTC8325        FRFNVLTYKELTYLPFGSKLYQIKKGRR
    Newman          FRFNVLTYKELTYLPFGSKLYQIKKGRR
    USA300_FPR3757  FRFNVLTYKELTYLPFGSKLYQIKKGRR
                    ****************************