Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002249000
  • symbol?:
  • description?: RNA binding protein, contains ribosomal protein S1 domain

      descriptions from strain specific annotations:

    • RNA binding protein, contains ribosomal protein S1 domain
    • general stress protein 13 (GSP13)
    • polyribonucleotide nucleotidyltransferase
    • putative RNA binding protein
    • RNA binding S1 domain-containing protein
    • S1 RNA binding domain-containing protein
    • S1-type RNA-binding domain-containing protein
  • strand?: +
  • coordinates?: 2756524..2756925
  • synteny block?: BlockID0015480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0483
    08BA02176:
    C248_0564
    11819-97:
    MS7_0485
    71193:
    ST398NM01_0574
    ECT-R 2:
    ECTR2_448
    ED133:
    SAOV_0530
    ED98:
    SAAV_0455
    HO 5096 0412:
    SAEMRSA15_04340
    JH1:
    SaurJH1_0543
    JH9:
    SaurJH9_0530
    JKD6008:
    SAA6008_00513
    JKD6159:
    SAA6159_00459
    LGA251:
    SARLGA251_04420
    M013:
    M013TW_0480
    MRSA252:
    SAR0509
    MSHR1132:
    SAMSHR1132_04520
    MSSA476:
    SAS0465
    Mu3:
    SAHV_0505
    Mu50:
    SAV0508
    MW2:
    MW0463
    RF122:
    SAB0457
    ST398:
    SAPIG0574
    T0131:
    SAT0131_00554
    TCH60:
    HMPREF0772_10011
    TW20:
    SATW20_05760
    USA300_TCH1516:
    USA300HOU_0502
    VC40:
    SAVC_02125

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSIEVGNKLKGKVTGIKKFGAFVELPEGKSGLVHISEVADNYVENVEEHLSVGDEVDVKV
    N315            MSIEVGNKLKGKVTGIKKFGAFVELPEGKSGLVHISEVADNYVENVEEHLSVGDEVDVKV
    NCTC8325        MSIEVGNKLKGKVTGIKKFGAFVELPEGKSGLVHISEVADNYVENVEEHLSVGDEVDVKV
    Newman          MSIEVGNKLKGKVTGIKKFGAFVELPEGKSGLVHISEVADNYVENVEEHLSVGDEVDVKV
    USA300_FPR3757  MSIEVGNKLKGKVTGIKKFGAFVELPEGKSGLVHISEVADNYVENVEEHLSVGDEVDVKV
                    ************************************************************

    COL             LSIADDGKISLSIKKAKDRPRRQHTSKPSHQKPVQKAEDFEKKLSNFLKDSEDKLTSIKR
    N315            LSIADDGKISLSIKKAKDRPRRQHTSKPSHQKPVQKAEDFEKKLSNFLKDSEDKLTSIKR
    NCTC8325        LSIADDGKISLSIKKAKDRPRRQHTSKPSHQKPVQKAEDFEKKLSNFLKDSEDKLTSIKR
    Newman          LSIADDGKISLSIKKAKDRPRRQHTSKPSHQKPVQKAEDFEKKLSNFLKDSEDKLTSIKR
    USA300_FPR3757  LSIADDGKISLSIKKAKDRPRRQHTSKPSHQKPVQKAEDFEKKLSNFLKDSEDKLTSIKR
                    ************************************************************

    COL             QTESRRGGKGSRR
    N315            QTESRRGGKGSRR
    NCTC8325        QTESRRGGKGSRR
    Newman          QTESRRGGKGSRR
    USA300_FPR3757  QTESRRGGKGSRR
                    *************