From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002250000
  • symbol?: tilS
  • description?: tRNA(Ile)-lysidine synthetase

      descriptions from strain specific annotations:

    • tRNA(Ile)-lysidine synthetase
    • tRNA(Ile)-lysidine synthase
    • tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase)
    • protein TilS
  • strand?: +
  • coordinates?: 2757107..2758402
  • synteny block?: BlockID0015490
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0471 (tilS)
    USA300_FPR3757:
    04-02981:
    SA2981_0484
    08BA02176:
    C248_0565
    11819-97:
    MS7_0486 (tilS)
    71193:
    ST398NM01_0575
    ECT-R 2:
    ECTR2_449 (tilS)
    ED133:
    SAOV_0531
    ED98:
    SAAV_0456
    HO 5096 0412:
    SAEMRSA15_04350
    JH1:
    SaurJH1_0544
    JH9:
    SaurJH9_0531
    JKD6008:
    SAA6008_00514 (tilS)
    JKD6159:
    SAA6159_00460 (tilS)
    LGA251:
    SARLGA251_04430 (tilS)
    M013:
    M013TW_0481
    MRSA252:
    SAR0510
    MSHR1132:
    SAMSHR1132_04530
    MSSA476:
    SAS0466
    Mu3:
    SAHV_0506
    Mu50:
    SAV0509
    MW2:
    MW0464
    RF122:
    SAB0458
    ST398:
    SAPIG0575
    T0131:
    SAT0131_00555 (menC)
    TCH60:
    HMPREF0772_10010
    TW20:
    SATW20_05770 (tilS)
    USA300_TCH1516:
    USA300HOU_0503
    VC40:
    SAVC_02130

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQLNSNGWHVDDHIVVAVSTGIDSMCLLYQLLNDYKDSYRKLTCLHVNHGVRSASIEEAR
    N315            MQLNSNGWHVDDHIVVAVSTGIDSMCLLYQLLNDYKDSYRKLTCLHVNHGVRSASIEEAR
    NCTC8325        MQLNSNGWHVDDHIVVAVSTGIDSMCLLYQLLNDYKDSYRKLTCLHVNHGVRSASIEEAR
    Newman          MQLNSNGWHVDDHIVVAVSTGIDSMCLLYQLLNDYKDSYRKLTCLHVNHGVRSASIEEAR
    USA300_FPR3757  MQLNSNGWHVDDHIVVAVSTGIDSMCLLYQLLNDYKDSYRKLTCLHVNHGVRSASIEEAR
                    ************************************************************

    COL             FLEAYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHL
    N315            FLEAYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHL
    NCTC8325        FLEAYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHL
    Newman          FLEAYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHL
    USA300_FPR3757  FLEAYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHL
                    ************************************************************

    COL             DDQLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSKKEIKQFQERYHIPYFED
    N315            DDQLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSKKEIKQFQERYHIPYFED
    NCTC8325        DDQLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSKKEIKQFQERYHIPYFED
    Newman          DDQLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSKKEIKQFQERYHIPYFED
    USA300_FPR3757  DDQLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSKKEIKQFQERYHIPYFED
                    ************************************************************

    COL             ESNKDNKYVRNDIRNRIIPAIDENNQLKVSHLLKLKQWHDEQYDILQYSAKQFIQEFVKF
    N315            ESNKDNKYIRNDIRNRIIPAIDENNQLKVSHLLKLKQWHDEQYDILQYSAKQFIQEFVKF
    NCTC8325        ESNKDNKYVRNDIRNRIIPAIDENNQLKVSHLLKLKQWHDEQYDILQYSAKQFIQEFVKF
    Newman          ESNKDNKYVRNDIRNRIIPAIDENNQLKVSHLLKLKQWHDEQYDILQYSAKQFIQEFVKF
    USA300_FPR3757  ESNKDNKYVRNDIRNRIIPAIDENNQLKVSHLLKLKQWHDEQYDILQYSAKQFIQEFVKF
                    ********:***************************************************

    COL             DEQSKYLEVSRQAFNNLPNSLKMVVLDCLLSKYYELFNISAKTYEEWFKQFSSKKAQFSI
    N315            DEQSKYLEVSRQAFNNLPNSLKMVVLDCLLSKYYELFNISAKTYEEWFKQFSSKKAQFSI
    NCTC8325        DEQSKYLEVSRQAFNNLPNSLKMVVLDCLLSKYYELFNISAKTYEEWFKQFSSKKAQFSI
    Newman          DEQSKYLEVSRQAFNNLPNSLKMVVLDCLLSKYYELFNISAKTYEEWFKQFSSKKAQFSI
    USA300_FPR3757  DEQSKYLEVSRQAFNNLPNSLKMVVLDCLLSKYYELFNISAKTYEEWFKQFSSKKAQFSI
                    ************************************************************

    COL             NLTDKWIIQIAYGKLIIMAKNNGDTYFRVQTIKKPGNYIFNKYRLEIHSNLPKCLFPLTV
    N315            NLTDKWIIQIAYGKLIIMAKNNGDTYFRVQTIKKPGNYFFNKYRLEIHSNLPKCLFPLTV
    NCTC8325        NLTDKWIIQIAYGKLIIMAKNNGDTYFRVQTIKKPGNYIFNKYRLEIHSNLPKCLFPLTV
    Newman          NLTDKWIIQIAYGKLIIMAKNNGDTYFRVQTIKKPGNYIFNKYRLEIHSNLPKCLFPLTV
    USA300_FPR3757  NLTDKWIIQIAYGKLIIMAKNNGDTYFRVQTIKKPGNYIFNKYRLEIHSNLPKCLFPLTV
                    **************************************:*********************

    COL             RTRQSGDTFKLNGRDGYKKVNRLFIDCKVPQWVRDQMPIVLDKQQRIIAVGDLYQQQTIK
    N315            RTRQSGDTFKLNGRDGYKKVNRLFIDCKVPQWVRDQMPIVLDKQQRIIAVGDLYQQQTIK
    NCTC8325        RTRQSGDTFKLNGRDGYKKVNRLFIDCKVPQWVRDQMPIVLDKQQRIIAVGDLYQQQTIK
    Newman          RTRQSGDTFKLNGRDGYKKVNRLFIDCKVPQWVRDQMPIVLDKQQRIIAVGDLYQQQTIK
    USA300_FPR3757  RTRQSGDTFKLNGRDGYKKVNRLFIDCKVPQWVRDQMPIVLDKQQRIIAVGDLYQQQTIK
                    ************************************************************

    COL             KWIIISKNGDE
    N315            KWIIISKNGDE
    NCTC8325        KWIIISKNGDE
    Newman          KWIIISKNGDE
    USA300_FPR3757  KWIIISKNGDE
                    ***********