From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002287000
  • symbol?: ctsR
  • description?: transcriptional regulator CtsR

      descriptions from strain specific annotations:

    • transcriptional regulator CtsR
    • class III stress genes transcriptional repressor
    • CtsR family transcriptional regulator
    • DNA-binding protein
    • putative DNA-binding protein
    • transcriptional repressor of stress genes
    • transcription repressor of class III stress genes homologue
    • transcription repressor of class III stress genes-like protein
  • strand?: +
  • coordinates?: 2808630..2809100
  • synteny block?: BlockID0015860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0567 (ctsR)
    N315:
    SA0480 (ctsR)
    NCTC8325:
    Newman:
    NWMN_0484 (ctsR)
    USA300_FPR3757:
    04-02981:
    SA2981_0497 (ctsR)
    08BA02176:
    C248_0594
    11819-97:
    MS7_0511 (ctsR)
    71193:
    ST398NM01_0597
    ECT-R 2:
    ECTR2_475
    ED133:
    SAOV_0557
    ED98:
    SAAV_0483 (ctsR)
    HO 5096 0412:
    SAEMRSA15_04480
    JH1:
    SaurJH1_0558
    JH9:
    SaurJH9_0544
    JKD6008:
    SAA6008_00528 (ctsR)
    JKD6159:
    SAA6159_00475 (ctsR)
    LGA251:
    SARLGA251_04570 (ctsR)
    M013:
    M013TW_0506
    MRSA252:
    SAR0525
    MSHR1132:
    SAMSHR1132_04660
    MSSA476:
    SAS0479
    Mu3:
    SAHV_0519 (ctsR)
    Mu50:
    SAV0522 (ctsR)
    MW2:
    MW0477 (ctsR)
    RF122:
    SAB0472
    ST398:
    SAPIG0597
    T0131:
    SAT0131_00572
    TCH60:
    HMPREF0772_12669 (ctsR)
    TW20:
    SATW20_05910 (ctsR)
    USA300_TCH1516:
    USA300HOU_0515 (ctsR)
    VC40:
    SAVC_02195

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHNMSDIIEQYIKRLFEESNEDVVEIQRANIAQRFDCVPSQLNYVIKTRFTNEHGYEIES
    N315            MHNMSDIIEQYIKRLFEESNEDVVEIQRANIAQRFDCVPSQLNYVIKTRFTNEHGYEIES
    NCTC8325        MHNMSDIIEQYIKRLFEESNEDVVEIQRANIAQRFDCVPSQLNYVIKTRFTNEHGYEIES
    Newman          MHNMSDIIEQYIKRLFEESNEDVVEIQRANIAQRFDCVPSQLNYVIKTRFTNEHGYEIES
    USA300_FPR3757  MHNMSDIIEQYIKRLFEESNEDVVEIQRANIAQRFDCVPSQLNYVIKTRFTNEHGYEIES
                    ************************************************************

    COL             KRGGGGYIRITKIENKDATGYINHLLQLIGPSISQQQAYYIIDGLLDKMLINEREAKMIQ
    N315            KRGGGGYIRITKIENKDATGYINHLLQLIGPSISQQQAYYIIDGLLDKMLINEREAKMIQ
    NCTC8325        KRGGGGYIRITKIENKDATGYINHLLQLIGPSISQQQAYYIIDGLLDKMLINEREAKMIQ
    Newman          KRGGGGYIRITKIENKDATGYINHLLQLIGPSISQQQAYYIIDGLLDKMLINEREAKMIQ
    USA300_FPR3757  KRGGGGYIRITKIENKDATGYINHLLQLIGPSISQQQAYYIIDGLLDKMLINEREAKMIQ
                    ************************************************************

    COL             AVIDRETLSMDMVSRDIIRANILKRLLPVINYY
    N315            AVIDRETLSMDMVSRDIIRANILKRLLPVINYY
    NCTC8325        AVIDRETLSMDMVSRDIIRANILKRLLPVINYY
    Newman          AVIDRETLSMDMVSRDIIRANILKRLLPVINYY
    USA300_FPR3757  AVIDRETLSMDMVSRDIIRANILKRLLPVINYY
                    *********************************