From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002289000
  • symbol?: mcsB
  • description?: ATP:guanido phosphotransferase

      descriptions from strain specific annotations:

    • ATP:guanido phosphotransferase
    • Arginine kinase
    • ATP:guanido phosphotransferase, C-terminal catalytic domain protein
    • putative ATP:guanido phosphotransferase
    • ATP:guanido phosphotransferase family protein
    • putative phosphotransferase
    • D-isomer specific 2-hydroxyacid dehydrogenase family protein
    • putative ATP:guanido phosphotransferase YacI
  • strand?: +
  • coordinates?: 2809660..2810682
  • synteny block?: BlockID0015880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0499
    08BA02176:
    C248_0596
    11819-97:
    MS7_0513
    71193:
    ST398NM01_0599
    ECT-R 2:
    ECTR2_477
    ED133:
    SAOV_0559
    ED98:
    SAAV_0485
    HO 5096 0412:
    SAEMRSA15_04500
    JH1:
    SaurJH1_0560
    JH9:
    SaurJH9_0546
    JKD6008:
    SAA6008_00530
    JKD6159:
    SAA6159_00477
    LGA251:
    SARLGA251_04590
    M013:
    M013TW_0508
    MRSA252:
    SAR0527
    MSHR1132:
    SAMSHR1132_04680
    MSSA476:
    SAS0481
    Mu3:
    SAHV_0521
    Mu50:
    SAV0524
    MW2:
    MW0479
    RF122:
    SAB0474
    ST398:
    SAPIG0599
    T0131:
    SAT0131_00574 (hsdS)
    TCH60:
    HMPREF0772_12667
    TW20:
    SATW20_05930
    USA300_TCH1516:
    USA300HOU_0517
    VC40:
    SAVC_02205

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDAL
    N315            -MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDAL
    NCTC8325        -MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDAL
    Newman          MMTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDAL
    USA300_FPR3757  -MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQDAL
                     ***********************************************************

    COL             PNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAM
    N315            PNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAM
    NCTC8325        PNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAM
    Newman          PNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAM
    USA300_FPR3757  PNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESLSVMINEEDHIRIQAM
                    ************************************************************

    COL             GTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIM
    N315            GTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIM
    NCTC8325        GTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIM
    Newman          GTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIM
    USA300_FPR3757  GTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRASVMLHLPGLSIM
                    ************************************************************

    COL             KRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIH
    N315            KRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIH
    NCTC8325        KRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIH
    Newman          KRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIH
    USA300_FPR3757  KRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIETLTEVVNQIIH
                    ************************************************************

    COL             EEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNF
    N315            DEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNF
    NCTC8325        EEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNF
    Newman          EEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNF
    USA300_FPR3757  EEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLGIDLNYIELQNF
                    :***********************************************************

    COL             KFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK
    N315            KFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK
    NCTC8325        KFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK
    Newman          KFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK
    USA300_FPR3757  KFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK
                    ************************************