From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002299000
  • symbol?: mrnC
  • description?: Mini-ribonuclease 3

      descriptions from strain specific annotations:

    • Mini-ribonuclease 3
    • ribonuclease III
    • cysteinyl-tRNA synthetase like-protein
    • putative cysteinyl-tRNA synthetase
    • putative ribonuclease
    • ribonuclease III family protein
    • RNase3 domain-containing protein
    • Small protein
  • strand?: +
  • coordinates?: 2820610..2821014
  • synteny block?: BlockID0015980
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0506
    08BA02176:
    C248_0604
    11819-97:
    MS7_0520
    71193:
    ST398NM01_0606
    ECT-R 2:
    ECTR2_484
    ED133:
    SAOV_0566
    ED98:
    SAAV_0492
    HO 5096 0412:
    SAEMRSA15_04570
    JH1:
    SaurJH1_0567
    JH9:
    SaurJH9_0553
    JKD6008:
    SAA6008_00537
    JKD6159:
    SAA6159_00484
    LGA251:
    SARLGA251_04660
    M013:
    M013TW_0515
    MRSA252:
    SAR0534
    MSHR1132:
    SAMSHR1132_04750
    MSSA476:
    SAS0488
    Mu3:
    SAHV_0528 (cysS)
    Mu50:
    SAV0530.1 (cysS)
    MW2:
    MW0486
    RF122:
    SAB0481
    ST398:
    SAPIG0606 (cysS)
    T0131:
    SAT0131_00583 (bsaG)
    TCH60:
    HMPREF0772_12659
    TW20:
    SATW20_06000
    USA300_TCH1516:
    USA300HOU_0524
    VC40:
    SAVC_02240

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDNQQDNHIKLLNPLTLAYMGDAVLDQYVRTYIVLKLKSKPNKLHQMSKKYVSAKSQAQT
    N315            MDNQQDNHIKLLNPLTLAYMGDAVLDQYVRTYIVLKLKSKPNKLHQMSKKYVSAKSQAQT
    NCTC8325        MDNQQDNHIKLLNPLTLAYMGDAVLDQYVRTYIVLKLKSKPNKLHQMSKKYVSAKSQAQT
    Newman          MDNQQDNHIKLLNPLTLAYMGDAVLDQYVRTYIVLKLKSKPNKLHQMSKKYVSAKSQAQT
    USA300_FPR3757  MDNQQDNHIKLLNPLTLAYMGDAVLDQYVRTYIVLKLKSKPNKLHQMSKKYVSAKSQAQT
                    ************************************************************

    COL             LEYLMEQEWFTDEEMDILKRGRNAKSHTKAKNTDVQTYRKSSAIEAVIGFLYLEKREERL
    N315            LEYLMEQEWFTDEEMDILKRGRNAKSHTKAKNTDVQTYRKSSAIEAVIGFLYLEKREERL
    NCTC8325        LEYLMEQEWFTDEEMDILKRGRNAKSHTKAKNTDVQTYRKSSAIEAVIGFLYLEKREERL
    Newman          LEYLMEQEWFTDEEMDILKRGRNAKSHTKAKNTDVQTYRKSSAIEAVIGFLYLEKREERL
    USA300_FPR3757  LEYLMEQEWFTDEEMDILKRGRNAKSHTKAKNTDVQTYRKSSAIEAVIGFLYLEKREERL
                    ************************************************************

    COL             EALLNKIITIVNER
    N315            EALLNKIITIVNER
    NCTC8325        EALLNKIITIVNER
    Newman          EALLNKIITIVNER
    USA300_FPR3757  EALLNKIITIVNER
                    **************