From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002301000
  • symbol?:
  • description?: yacP-like NYN domain protein
  • strand?: +
  • coordinates?: 2821768..2822292
  • synteny block?: BlockID0016000
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0508
    08BA02176:
    C248_0606
    11819-97:
    MS7_0522
    71193:
    ST398NM01_0608
    ECT-R 2:
    ECTR2_486
    ED133:
    SAOV_0568
    ED98:
    SAAV_0494
    HO 5096 0412:
    SAEMRSA15_04590
    JH1:
    SaurJH1_0569
    JH9:
    SaurJH9_0555
    JKD6008:
    SAA6008_00539
    JKD6159:
    SAA6159_00486
    LGA251:
    SARLGA251_04680
    M013:
    M013TW_0517
    MRSA252:
    SAR0536
    MSHR1132:
    SAMSHR1132_04770
    MSSA476:
    SAS0490
    Mu3:
    SAHV_0530
    Mu50:
    SAV0532
    MW2:
    MW0488
    RF122:
    SAB0483
    ST398:
    SAPIG0608
    T0131:
    SAT0131_00585 (bsaF)
    TCH60:
    HMPREF0772_12657
    TW20:
    SATW20_06020
    USA300_TCH1516:
    USA300HOU_0526
    VC40:
    SAVC_02250

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKERYLIIDGYNMIGQSPTLSAIAKENLEEARMQLIDAIANYNAVISDEIICVFDAYDQS
    N315            MKERYLIIDGYNMIGQSPTLSAIAKENLEEARMQLIDAIANYNAVISDEIICVFDAYDQS
    NCTC8325        MKERYLIIDGYNMIGQSPTLSAIAKENLEEARMQLIDAIANYNAVISDEIICVFDAYDQS
    Newman          MKERYLIIDGYNMIGQSPTLSAIAKENLEEARMQLIDAIANYNAVISDEIICVFDAYDQS
    USA300_FPR3757  MKERYLIIDGYNMIGQSPTLSAIAKENLEEARMQLIDAIANYNAVISDEIICVFDAYDQS
                    ************************************************************

    COL             GVEREYMYHGVKTIFTKEKETADSFIERYVYELYDKHTKHITVVTSDMSEQHAIFGSGAY
    N315            GVEREYMYHGVKTIFTKEKETADSFIERYVYELYDKHTKHIAVVTSDMSEQHAIFGSGAY
    NCTC8325        GVEREYMYHGVKTIFTKEKETADSFIERYVYELYDKHTKHITVVTSDMSEQHAIFGSGAY
    Newman          GVEREYMYHGVKTIFTKEKETADSFIERYVYELYDKHTKHITVVTSDMSEQHAIFGSGAY
    USA300_FPR3757  GVEREYMYHGVKTIFTKEKETADSFIERYVYELYDKHTKHITVVTSDMSEQHAIFGSGAY
                    *****************************************:******************

    COL             RISSREMWRDLKENEIDVSKSLDDISENKPRTRIPLSSEILAEFEKIRRGHHKK
    N315            RISSREMWRDLKENEIDVSKSLDDISENKPRTRIPLSSEILAEFEKIRRGHHKK
    NCTC8325        RISSREMWRDLKENEIDVSKSLDDISENKPRTRIPLSSEILAEFEKIRRGHHKK
    Newman          RISSREMWRDLKENEIDVSKSLDDISENKPRTRIPLSSEILAEFEKIRRGHHKK
    USA300_FPR3757  RISSREMWRDLKENEIDVSKSLDDISENKPRTRIPLSSEILAEFEKIRRGHHKK
                    ******************************************************