From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002307000
  • symbol?: rplK
  • description?: 50S ribosomal protein L11

      descriptions from strain specific annotations:

    • 50S ribosomal protein L11
    • 50S ribosomalprotein L11p (L12e)
  • strand?: +
  • coordinates?: 2824173..2824604
  • synteny block?: BlockID0016060
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0583 (rplK)
    N315:
    SA0495 (rplK)
    NCTC8325:
    Newman:
    NWMN_0499 (rplK)
    USA300_FPR3757:
    04-02981:
    SA2981_0514 (rplK)
    08BA02176:
    C248_0612 (rplK)
    11819-97:
    MS7_0527 (rplK)
    71193:
    ST398NM01_0612
    ECT-R 2:
    ECTR2_491 (rplK)
    ED133:
    SAOV_0572
    ED98:
    SAAV_0499 (rplK)
    HO 5096 0412:
    SAEMRSA15_04640 (rplK)
    JH1:
    SaurJH1_0574 (rplK)
    JH9:
    SaurJH9_0560 (rplK)
    JKD6008:
    SAA6008_00543 (rplK)
    JKD6159:
    SAA6159_00490 (rplK)
    LGA251:
    SARLGA251_04730 (rplK)
    M013:
    M013TW_0522
    MRSA252:
    SAR0542 (rplK)
    MSHR1132:
    SAMSHR1132_04810
    MSSA476:
    SAS0495 (rplK)
    Mu3:
    SAHV_0535 (rplK)
    Mu50:
    SAV0537 (rplK)
    MW2:
    MW0492 (rplK)
    RF122:
    SAB0488 (rplK)
    ST398:
    SAPIG0612 (rplK)
    T0131:
    SAT0131_00589 (bsaB)
    TCH60:
    HMPREF0772_12652 (rplK)
    TW20:
    SATW20_06070 (rplK)
    USA300_TCH1516:
    USA300HOU_0531 (rplK)
    VC40:
    SAVC_02275 (rplK)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHIVAKKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVE
    N315            ---MAKKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVE
    NCTC8325        ---MAKKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVE
    Newman          MHIVAKKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVE
    USA300_FPR3757  ---MAKKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVE
                       :********************************************************

    COL             ISVYEDRSFTFITKTPPAPVLLKKAAGIEKGSGEPNKTKVATVTKNQVREIANSKMQDLN
    N315            ISVYEDRSFTFITKTPPAPVLLKKAAGIEKGSGEPNKTKVATVTKDQVREIANSKMQDLN
    NCTC8325        ISVYEDRSFTFITKTPPAPVLLKKAAGIEKGSGEPNKTKVATVTKDQVREIANSKMQDLN
    Newman          ISVYEDRSFTFITKTPPAPVLLKKAAGIEKGSGEPNKTKVATVTKNQVREIANSKMQDLN
    USA300_FPR3757  ISVYEDRSFTFITKTPPAPVLLKKAAGIEKGSGEPNKTKVATVTKDQVREIANSKMQDLN
                    *********************************************:**************

    COL             AADEEAAMRIIEGTARSMGIVVE
    N315            AADEEAAMRIIEGTARSMGIVVE
    NCTC8325        AADEEAAMRIIEGTARSMGIVVE
    Newman          AADEEAAMRIIEGTARSMGIVVE
    USA300_FPR3757  AADEEAAMRIIEGTARSMGIVVE
                    ***********************