From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002311000
  • symbol?: rplL
  • description?: 50S ribosomal protein L7/L12

      descriptions from strain specific annotations:

    • 50S ribosomal protein L7/L12
    • 50S ribosomalprotein L7/L12 (L23e)
    • 50S ribosomal protein L12
  • strand?: +
  • coordinates?: 2826319..2826688
  • synteny block?: BlockID0016100
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0586 (rplL)
    N315:
    SA0498 (rplL)
    NCTC8325:
    Newman:
    NWMN_0502 (rplL)
    USA300_FPR3757:
    04-02981:
    SA2981_0517 (rplL)
    08BA02176:
    C248_0615 (rplL)
    11819-97:
    MS7_0530 (rplL)
    71193:
    ST398NM01_0615
    ECT-R 2:
    ECTR2_494 (rplL)
    ED133:
    SAOV_0575 (rplL)
    ED98:
    SAAV_0503 (rplL)
    HO 5096 0412:
    SAEMRSA15_04670 (rplL)
    JH1:
    SaurJH1_0577 (rplL)
    JH9:
    SaurJH9_0563 (rplL)
    JKD6008:
    SAA6008_00546 (rplL)
    JKD6159:
    SAA6159_00493 (rplL)
    LGA251:
    SARLGA251_04760 (rplL)
    M013:
    M013TW_0525
    MRSA252:
    SAR0545 (rplL)
    MSHR1132:
    SAMSHR1132_04840
    MSSA476:
    SAS0498 (rplL)
    Mu3:
    SAHV_0538 (rplL)
    Mu50:
    SAV0540 (rplL)
    MW2:
    MW0495 (rplL)
    RF122:
    SAB0491 (rplL)
    ST398:
    SAPIG0615 (rplL)
    T0131:
    SAT0131_00593 (lukD)
    TCH60:
    HMPREF0772_12649 (rplL4)
    TW20:
    SATW20_06100 (rplL)
    USA300_TCH1516:
    USA300HOU_0534 (rplL)
    VC40:
    SAVC_02290 (rplL)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
    N315            MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
    NCTC8325        MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
    Newman          MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
    USA300_FPR3757  MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
                    ************************************************************

    COL             TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
    N315            TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
    NCTC8325        TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
    Newman          TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
    USA300_FPR3757  TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
                    ************************************************************

    COL             LK
    N315            LK
    NCTC8325        LK
    Newman          IK
    USA300_FPR3757  LK
                    :*