From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002312000
  • symbol?: rsmC
  • description?: methyltransferase

      descriptions from strain specific annotations:

    • methyltransferase
    • methyltransferase small subunit
    • 16S rRNA m(2)G 1207 methyltransferase
    • methyltransferase domain protein
    • methyltransferase small domain-containing protein
    • methyltransferase small domain superfamily
    • putative methyltransferase
    • ribosomal RNA small subunit methyltransferase C
  • strand?: +
  • coordinates?: 2826879..2827197
  • synteny block?: BlockID0016110
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0518
    08BA02176:
    C248_0616
    11819-97:
    MS7_0531
    71193:
    ST398NM01_0616
    ECT-R 2:
    ECTR2_495
    ED133:
    SAOV_0576
    ED98:
    SAAV_0504
    HO 5096 0412:
    SAEMRSA15_04680
    JH1:
    SaurJH1_0578
    JH9:
    SaurJH9_0564
    JKD6008:
    SAA6008_00547
    JKD6159:
    SAA6159_00494
    LGA251:
    SARLGA251_04770
    M013:
    M013TW_0527
    MRSA252:
    SAR0546
    MSHR1132:
    SAMSHR1132_04850
    MSSA476:
    SAS0499
    Mu3:
    SAHV_0539
    Mu50:
    SAV0541
    MW2:
    MW0496
    RF122:
    SAB0492
    ST398:
    SAPIG0616
    T0131:
    SAT0131_00594 (lukE)
    TCH60:
    HMPREF0772_12648
    TW20:
    SATW20_06110
    USA300_TCH1516:
    USA300HOU_0535
    VC40:
    SAVC_02295

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSHYYDEDPSVISNEQRIQYQLNHHKIDLITDNGVFSKDKVDYGSDVLVQTFLKAHPPGP
    N315            MSHYYDEDPSVISNEQRIQYQLNHHKIDLITDNGVFSKDKVDYGSDVLVQTFLKAHPPGP
    NCTC8325        MSHYYDEDPSVISNEQRIQYQLNHHKIDLITDNGVFSKDKVDYGSDVLVQTFLKAHPPGP
    Newman          MSHYYDEDPSVISNEQRIQYQLNHHKIDLITDNGVFSKDKVDYGSDVLVQTFLKAHPPGP
    USA300_FPR3757  MSHYYDEDPSVISNEQRIQYQLNHHKIDLITDNGVFSKDKVDYGSDVLVQTFLKAHPPGP
                    ************************************************************

    COL             SKRIADVGCGYGPIGLMIAKVSPHHSITMLDVNHRALALVEKNKKLNGIDNVIVKESDAL
    N315            SKRIADVGCGYGPIGLMIAKVSPHHSITMLDVNHRALALVEKNKKLNGIDNVIVKESDAL
    NCTC8325        SKRIADVGCGYGPIGLMIAKVSPHHSITMLDVNHRALALVEKNKKLNGIDNVIVKESDAL
    Newman          SKRIADVGCGYGPIGLMIAKVSPHHSITMLDVNHRALALVEKNKKLNGIDNVIVKESDAL
    USA300_FPR3757  SKRIADVGCGYGPIGLMIAKVSPHHSITMLDVNHRALALVEKNKKLNGIDNVIVKESDAL
                    ************************************************************

    COL             SAVEDKSFDFILTNPPIRAGKETVHRIFEQALHRLDSNGELFVVIQKKQGMPSAKKRMNE
    N315            SAVEDKSFDFILTNPPIRAGKETVHRIFEQALHRLDSNGELFVVIQKKQGMPSAKKRMNE
    NCTC8325        SAVEDKSFDFILTNPPIRAGKETVHRIFEQALHRLDSNGELFVVIQKKQGMPSAKKRMNE
    Newman          SAVEDKSFDFILTNPPIRAGKETVHRIFEQALHRLDSNGELFVVIQKKQGMPSAKKRMNE
    USA300_FPR3757  SAVEDKSFDFILTNPPIRAGKETVHRIFEQALHRLDSNGELFVVIQKKQGMPSAKKRMNE
                    ************************************************************

    COL             LFGNVEVVNKDKGYYILRSIKA
    N315            LFGNVEVVNKDKGYYILRSIKA
    NCTC8325        LFGNVEVVNKDKGYYILRSIKA
    Newman          LFGNVEVVNKDKGYYILRSIKA
    USA300_FPR3757  LFGNVEVVNKDKGYYILRSIKA
                    **********************