From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002314000
  • symbol?: rpoB
  • description?: DNA-directed RNA polymerase subunit beta

      descriptions from strain specific annotations:

    • DNA-directed RNA polymerase subunit beta
    • DNA-directed RNA polymerase, beta subunit
    • DNA-directed RNA polymerase beta chain protein
    • DNA-directed RNA polymerase beta subunit
  • strand?: +
  • coordinates?: 2827702..2831253
  • synteny block?: BlockID0016130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0588 (rpoB)
    N315:
    SA0500 (rpoB)
    NCTC8325:
    Newman:
    NWMN_0504 (rpoB)
    USA300_FPR3757:
    04-02981:
    SA2981_0519 (rpoB)
    08BA02176:
    C248_0617 (rpoB)
    11819-97:
    MS7_0532 (rpoB)
    71193:
    ST398NM01_0617
    ECT-R 2:
    ECTR2_496 (rpoB)
    ED133:
    SAOV_0577 (rpoB)
    ED98:
    SAAV_0505 (rpoB)
    HO 5096 0412:
    SAEMRSA15_04690 (rpoB)
    JH1:
    SaurJH1_0579 (rpoB)
    JH9:
    SaurJH9_0565 (rpoB)
    JKD6008:
    SAA6008_00548 (rpoB)
    JKD6159:
    SAA6159_00496 (rpoB)
    LGA251:
    SARLGA251_04780 (rpoB)
    M013:
    M013TW_0529
    MRSA252:
    SAR0547 (rpoB)
    MSHR1132:
    SAMSHR1132_04860
    MSSA476:
    SAS0500 (rpoB)
    Mu3:
    SAHV_0540 (rpoB)
    Mu50:
    SAV0542 (rpoB)
    MW2:
    MW0497 (rpoB)
    RF122:
    SAB0493 (rpoB)
    ST398:
    SAPIG0617 (rpoB)
    T0131:
    SAT0131_00595
    TCH60:
    HMPREF0772_12647 (rpoB)
    TW20:
    SATW20_06120 (rpoB)
    USA300_TCH1516:
    USA300HOU_0536 (rpoB)
    VC40:
    SAVC_02300 (rpoB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAGQVVQYGRHRKRRNYARISEVLELPNLIEIQTKSYEWFLREGLIEMFRDISPIEDFTG
    N315            MAGQVVQYGRHRKRRNYARISEVLELPNLIEIQTKSYEWFLREGLIEMFRDISPIEDFTG
    NCTC8325        MAGQVVQYGRHRKRRNYARISEVLELPNLIEIQTKSYEWFLREGLIEMFRDISPIEDFTG
    Newman          MAGQVVQYGRHRKRRNYARISEVLELPNLIEIQTKSYEWFLREGLIEMFRDISPIEDFTG
    USA300_FPR3757  MAGQVVQYGRHRKRRNYARISEVLELPNLIEIQTKSYEWFLREGLIEMFRDISPIEDFTG
                    ************************************************************

    COL             NLSLEFVDYRLGEPKYDLEESKNRDATYAAPLRVKVRLIIKETGEVKEQEVFMGDFPLMT
    N315            NLSLEFVDYRLGEPKYDLEESKNRDATYAAPLRVKVRLIIKETGEVKEQEVFMGDFPLMT
    NCTC8325        NLSLEFVDYRLGEPKYDLEESKNRDATYAAPLRVKVRLIIKETGEVKEQEVFMGDFPLMT
    Newman          NLSLEFVDYRLGEPKYDLEESKNRDATYAAPLRVKVRLIIKETGEVKEQEVFMGDFPLMT
    USA300_FPR3757  NLSLEFVDYRLGEPKYDLEESKNRDATYAAPLRVKVRLIIKETGEVKEQEVFMGDFPLMT
                    ************************************************************

    COL             DTGTFVINGAERVIVSQLVRSPSVYFNEKIDKNGRENYDATIIPNRGAWLEYETDAKDVV
    N315            DTGTFVINGAERVIVSQLVRSPSVYFNEKIDKNGRENYDATIIPNRGAWLEYETDAKDVV
    NCTC8325        DTGTFVINGAERVIVSQLVRSPSVYFNEKIDKNGRENYDATIIPNRGAWLEYETDAKDVV
    Newman          DTGTFVINGAERVIVSQLVRSPSVYFNEKIDKNGRENYDATIIPNRGAWLEYETDAKDVV
    USA300_FPR3757  DTGTFVINGAERVIVSQLVRSPSVYFNEKIDKNGRENYDATIIPNRGAWLEYETDAKDVV
                    ************************************************************

    COL             YVRIDRTRKLPLTVLLRALGFSSDQEIVDLLGDNEYLRNTLEKDGTENTEQALLEIYERL
    N315            YVRIDRTRKLPLTVLLRALGFSSDQEIVDLLGDNEYLRNTLEKDGTENTEQALLEIYERL
    NCTC8325        YVRIDRTRKLPLTVLLRALGFSSDQEIVDLLGDNEYLRNTLEKDGTENTEQALLEIYERL
    Newman          YVRIDRTRKLPLTVLLRALGFSSDQEIVDLLGDNEYLRNTLEKDGTENTEQALLEIYERL
    USA300_FPR3757  YVRIDRTRKLPLTVLLRALGFSSDQEIVDLLGDNEYLRNTLEKDGTENTEQALLEIYERL
                    ************************************************************

    COL             RPGEPPTVENAKSLLYSRFFDPKRYDLASVGRYKTNKKLHLKHRLFNQKLAEPIVNTETG
    N315            RPGEPPTVENAKSLLYSRFFDPKRYDLASVGRYKTNKKLHLKHRLFNQKLAEPIVNTETG
    NCTC8325        RPGEPPTVENAKSLLYSRFFDPKRYDLASVGRYKTNKKLHLKHRLFNQKLAEPIVNTETG
    Newman          RPGEPPTVENAKSLLYSRFFDPKRYDLASVGRYKTNKKLHLKHRLFNQKLAEPIVNTETG
    USA300_FPR3757  RPGEPPTVENAKSLLYSRFFDPKRYDLASVGRYKTNKKLHLKHRLFNQKLAEPIVNTETG
                    ************************************************************

    COL             EIVVEEGTVLDRRKIDEIMDVLESNANSEVFELHGSVIDEPVEIQSIKVYVPNDDEGRTT
    N315            EIVVEEGTVLDRRKIDEIMDVLESNANSEVFELHGSVIDEPVEIQSIKVYVPNDDEGRTT
    NCTC8325        EIVVEEGTVLDRRKIDEIMDVLESNANSEVFELHGSVIDEPVEIQSIKVYVPNDDEGRTT
    Newman          EIVVEEGTVLDRRKIDEIMDVLESNANSEVFELHGSVIDEPVEIQSIKVYVPNDDEGRTT
    USA300_FPR3757  EIVVEEGTVLDRRKIDEIMDVLESNANSEVFELHGSVIDEPVEIQSIKVYVPNDDEGRTT
                    ************************************************************

    COL             TVIGNAFPDSEVKCITPADIIASMSYFFNLLSGIGYTDDIDHLGNRRLRSVGELLQNQFR
    N315            TVIGNAFPDSEVKCITPADIIASMSYFFNLLSGIGYTDDIDHLGNRRLRSVGELLQNQFR
    NCTC8325        TVIGNAFPDSEVKCITPADIIASMSYFFNLLSGIGYTDDIDHLGNRRLRSVGELLQNQFR
    Newman          TVIGNAFPDSEVKCITPADIIASMSYFFNLLSGIGYTDDIDHLGNRRLRSVGELLQNQFR
    USA300_FPR3757  TVIGNAFPDSEVKCITPADIIASMSYFFNLLSGIGYTDDIDHLGNRRLRSVGELLQNQFR
                    ************************************************************

    COL             IGLSRMERVVRERMSIQDTESITPQQLINIRPVIASIKEFFGSSQLSQFMDQANPLAELT
    N315            IGLSRMERVVRERMSIQDTESITPQQLINIRPVIASIKEFFGSSQLSQFMDQANPLAELT
    NCTC8325        IGLSRMERVVRERMSIQDTESITPQQLINIRPVIASIKEFFGSSQLSQFMDQANPLAELT
    Newman          IGLSRMERVVRERMSIQDTESITPQQLINIRPVIASIKEFFGSSQLSQFMDQANPLAELT
    USA300_FPR3757  IGLSRMERVVRERMSIQDTESITPQQLINIRPVIASIKEFFGSSQLSQFMDQANPLAELT
                    ************************************************************

    COL             HKRRLSALGPGGLTRERAQMEVRDVHYSHYGRMCPIETPEGPNIGLINSLSSYARVNEFG
    N315            HKRRLSALGPGGLTRERAQMEVRDVHYSHYGRMCPIETPEGPNIGLINSLSSYARVNEFG
    NCTC8325        HKRRLSALGPGGLTRERAQMEVRDVHYSHYGRMCPIETPEGPNIGLINSLSSYARVNEFG
    Newman          HKRRLSALGPGGLTRERAQMEVRDVHYSHYGRMCPIETPEGPNIGLINSLSSYARVNEFG
    USA300_FPR3757  HKRRLSALGPGGLTRERAQMEVRDVHYSHYGRMCPIETPEGPNIGLINSLSSYARVNEFG
                    ************************************************************

    COL             FIETPYRKVDLDTHAITDQIDYLTADEEDSYVVAQANSKLDENGRFMDDEVVCRFRGNNT
    N315            FIETPYRKVDLDTHAITDQIDYLTADEEDSYVVAQANSKLDENGRFMDDEVVCRFRGNNT
    NCTC8325        FIETPYRKVDLDTHAITDQIDYLTADEEDSYVVAQANSKLDENGRFMDDEVVCRFRGNNT
    Newman          FIETPYRKVDLDTHAITDQIDYLTADEEDSYVVAQANSKLDENGRFMDDEVVCRFRGNNT
    USA300_FPR3757  FIETPYRKVDLDTHAITDQIDYLTADEEDSYVVAQANSKLDENGRFMDDEVVCRFRGNNT
                    ************************************************************

    COL             VMAKEKMDYMDVSPKQVVSAATACIPFLENDDSNRALMGANMQRQAVPLMNPEAPFVGTG
    N315            VMAKEKMDYMDVSPKQVVSAATACIPFLENDDSNRALMGANMQRQAVPLMNPEAPFVGTG
    NCTC8325        VMAKEKMDYMDVSPKQVVSAATACIPFLENDDSNRALMGANMQRQAVPLMNPEAPFVGTG
    Newman          VMAKEKMDYMDVSPKQVVSAATACIPFLENDDSNRALMGANMQRQAVPLMNPEAPFVGTG
    USA300_FPR3757  VMAKEKMDYMDVSPKQVVSAATACIPFLENDDSNRALMGANMQRQAVPLMNPEAPFVGTG
                    ************************************************************

    COL             MEHVAARDSGAAITAKHRGRVEHVESNEILVRRLVEENGVEHEGELDRYPLAKFKRSNSG
    N315            MEHVAARDSGAAITAKHRGRVEHVESNEILVRRLVEENGVEHEGELDRYPLAKFKRSNSG
    NCTC8325        MEHVAARDSGAAITAKHRGRVEHVESNEILVRRLVEENGVEHEGELDRYPLAKFKRSNSG
    Newman          MEHVAARDSGAAITAKHRGRVEHVESNEILVRRLVEENGVEHEGELDRYPLAKFKRSNSG
    USA300_FPR3757  MEHVAARDSGAAITAKHRGRVEHVESNEILVRRLVEENGVEHEGELDRYPLAKFKRSNSG
                    ************************************************************

    COL             TCYNQRPIVAVGDVVEYNEILADGPSMELGEMALGRNVVVGFMTWDGYNYEDAVIMSERL
    N315            TCYNQRPIVAVGDVVEYNEILADGPSMELGEMALGRNVVVGFMTWDGYNYEDAVIMSERL
    NCTC8325        TCYNQRPIVAVGDVVEYNEILADGPSMELGEMALGRNVVVGFMTWDGYNYEDAVIMSERL
    Newman          TCYNQRPIVAVGDVVEYNEILADGPSMELGEMALGRNVVVGFMTWDGYNYEDAVIMSERL
    USA300_FPR3757  TCYNQRPIVAVGDVVEYNEILADGPSMELGEMALGRNVVVGFMTWDGYNYEDAVIMSERL
                    ************************************************************

    COL             VKDDVYTSIHIEEYESEVRDTKLGPEEITRDIPNVSESALKNLDDRGIVYIGAEVKDGDI
    N315            VKDDVYTSIHIEEYESEARDTKLGPEEITRDIPNVSESALKNLDDRGIVYIGAEVKDGDI
    NCTC8325        VKDDVYTSIHIEEYESEARDTKLGPEEITRDIPNVSESALKNLDDRGIVYIGAEVKDGDI
    Newman          VKDDVYTSIHIEEYESEARDTKLGPEEITRDIPNVSESALKNLDDRGIVYIGAEVKDGDI
    USA300_FPR3757  VKDDVYTSIHIEEYESEARDTKLGPEEITRDIPNVSESALKNLDDRGIVYIGAEVKDGDI
                    *****************.******************************************

    COL             LVGKVTPKGVTELTAEERLLHAIFGEKAREVRDTLLRVPHGAGGIVLDVKVFNREEGDDT
    N315            LVGKVTPKGVTELTAEERLLHAIFGEKAREVRDTSLRVPHGAGGIVLDVKVFNREEGDDT
    NCTC8325        LVGKVTPKGVTELTAEERLLHAIFGEKAREVRDTSLRVPHGAGGIVLDVKVFNREEGDDT
    Newman          LVGKVTPKGVTELTAEERLLHAIFGEKAREVRDTSLRVPHGAGGIVLDVKVFNREEGDDT
    USA300_FPR3757  LVGKVTPKGVTELTAEERLLHAIFGEKAREVRDTSLRVPHGAGGIVLDVKVFNREEGDDT
                    ********************************** *************************

    COL             LSPGVNQLVRVYIVQKRKIHVGDKMCGRHGNKGVISKIVPEEDMPYLPDGRPIDIMLNPL
    N315            LSPGVNQLVRVYIVQKRKIHVGDKMCGRHGNKGVISKIVPEEDMPYLPDGRPIDIMLNPL
    NCTC8325        LSPGVNQLVRVYIVQKRKIHVGDKMCGRHGNKGVISKIVPEEDMPYLPDGRPIDIMLNPL
    Newman          LSPGVNQLVRVYIVQKRKIHVGDKMCGRHGNKGVISKIVPEEDMPYLPDGRPIDIMLNPL
    USA300_FPR3757  LSPGVNQLVRVYIVQKRKIHVGDKMCGRHGNKGVISKIVPEEDMPYLPDGRPIDIMLNPL
                    ************************************************************

    COL             GVPSRMNIGQVLELHLGMAAKNLGIHVASPVFDGANDDDVWSTIEEAGMARDGKTVLYDG
    N315            GVPSRMNIGQVLELHLGMAAKNLGIHVASPVFDGANDDDVWSTIEEAGMARDGKTVLYDG
    NCTC8325        GVPSRMNIGQVLELHLGMAAKNLGIHVASPVFDGANDDDVWSTIEEAGMARDGKTVLYDG
    Newman          GVPSRMNIGQVLELHLGMAAKNLGIHVASPVFDGANDDDVWSTIEEAGMARDGKTVLYDG
    USA300_FPR3757  GVPSRMNIGQVLELHLGMAAKNLGIHVASPVFDGANDDDVWSTIEEAGMARDGKTVLYDG
                    ************************************************************

    COL             RTGEPFDNRISVGVMYMLKLAHMVDDKLHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEV
    N315            RTGEPFDNRISVGVMYMLKLAHMVDDKLHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEV
    NCTC8325        RTGEPFDNRISVGVMYMLKLAHMVDDKLHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEV
    Newman          RTGEPFDNRISVGVMYMLKLAHMVDDKLHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEV
    USA300_FPR3757  RTGEPFDNRISVGVMYMLKLAHMVDDKLHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEV
                    ************************************************************

    COL             WALEAYGAAYTLQEILTYKSDDTVGRVKTYEAIVKGENISRPSVPESFRVLMKELQSLGL
    N315            WALEAYGAAYTLQEILTYKSDDTVGRVKTYEAIVKGENISRPSVPESFRVLMKELQSLGL
    NCTC8325        WALEAYGAAYTLQEILTYKSDDTVGRVKTYEAIVKGENISRPSVPESFRVLMKELQSLGL
    Newman          WALEAYGAAYTLQEILTYKSDDTVGRVKTYEAIVKGENISRPSVPESFRVLMKELQSLGL
    USA300_FPR3757  WALEAYGAAYTLQEILTYKSDDTVGRVKTYEAIVKGENISRPSVPESFRVLMKELQSLGL
                    ************************************************************

    COL             DVKVMDEQDNEIEMTDVDDDDVVERKVDLQQNDAPETQKEVTD
    N315            DVKVMDEQDNEIEMTDVDDDDVVERKVDLQQNDAPETQKEVTD
    NCTC8325        DVKVMDEQDNEIEMTDVDDDDVVERKVDLQQNDAPETQKEVTD
    Newman          DVKVMDEQDNEIEMTDVDDDDVVERKVDLQQNDAPETQKEVTD
    USA300_FPR3757  DVKVMDEQDNEIEMTDVDDDDVVERKVDLQQNDAPETQKEVTD
                    *******************************************