From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002316000
  • symbol?: rplGB
  • description?: ribosomal protein L7Ae-like

      descriptions from strain specific annotations:

    • ribosomal protein L7Ae-like
    • putative ribosomal protein L7Ae-like
    • putative ribosomal protein L7Ae-like protein
    • Firmicutes ribosomal L7Ae family protein
    • 50S ribosomal protein L7/L12
    • ribosomal protein L7Ae/L30e/S12e/Gadd45
    • Large subunit ribosomal protein L7A
    • ribosomal L7Ae/L30e/S12e/Gadd45 family protein
    • 50S ribosomal protein L7AE
  • strand?: +
  • coordinates?: 2835095..2835406
  • synteny block?: BlockID0016150
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0521
    08BA02176:
    C248_0619
    11819-97:
    MS7_0534
    71193:
    ST398NM01_0619
    ECT-R 2:
    ECTR2_498
    ED133:
    SAOV_0579
    ED98:
    SAAV_0507
    HO 5096 0412:
    SAEMRSA15_04710
    JH1:
    SaurJH1_0581
    JH9:
    SaurJH9_0567
    JKD6008:
    SAA6008_00550
    JKD6159:
    SAA6159_00498
    LGA251:
    SARLGA251_04800
    M013:
    M013TW_0531
    MRSA252:
    SAR0549
    MSHR1132:
    SAMSHR1132_04880
    MSSA476:
    SAS0502
    Mu3:
    SAHV_0542
    Mu50:
    SAV0544
    MW2:
    MW0499
    RF122:
    SAB0495
    ST398:
    SAPIG0619
    T0131:
    SAT0131_00597
    TCH60:
    HMPREF0772_12645 (rplL3)
    TW20:
    SATW20_06140
    USA300_TCH1516:
    USA300HOU_0538
    VC40:
    SAVC_02310

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKEKVARFNKQHFVVGLKETLKALKKDQVTSLIIAEDVEVYLMTRVLSQINQKNIPVSF
    N315            MSKEKVARFNKQHFVVGLKETLKALKKDQVTSLIIAEDVEVYLMTRVLSQINQKNIPVSF
    NCTC8325        MSKEKVARFNKQHFVVGLKETLKALKKDQVTSLIIAEDVEVYLMTRVLSQINQKNIPVSF
    Newman          MSKEKVARFNKQHFVVGLKETLKALKKDQVTSLIIAEDVEVYLMTRVLSQINQKNIPVSF
    USA300_FPR3757  MSKEKVARFNKQHFVVGLKETLKALKKDQVTSLIIAEDVEVYLMTRVLSQINQKNIPVSF
                    ************************************************************

    COL             FKSKHALGKHVGINVNATIVALIK
    N315            FKSKHALGKHVGINVNATIVALIK
    NCTC8325        FKSKHALGKHVGINVNATIVALIK
    Newman          FKSKHALGKHVGINVNATIVALIK
    USA300_FPR3757  FKSKHALGKHVGINVNATIVALIK
                    ************************