From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002317000
  • symbol?: rpsL
  • description?: 30S ribosomal protein S12

      descriptions from strain specific annotations:

    • 30S ribosomal protein S12
    • 30S ribosomalprotein S12p (S23e)
  • strand?: +
  • coordinates?: 2835469..2835918
  • synteny block?: BlockID0016160
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0591 (rpsL)
    N315:
    SA0503 (rpsL)
    NCTC8325:
    Newman:
    NWMN_0507 (rpsL)
    USA300_FPR3757:
    04-02981:
    SA2981_0522 (rpsL)
    08BA02176:
    C248_0620 (rpsL)
    11819-97:
    MS7_0535 (rpsL)
    71193:
    ST398NM01_0620
    ECT-R 2:
    ECTR2_499 (rpsL)
    ED133:
    SAOV_0580
    ED98:
    SAAV_0508 (rpsL)
    HO 5096 0412:
    SAEMRSA15_04720 (rpsL)
    JH1:
    SaurJH1_0582 (rpsL)
    JH9:
    SaurJH9_0568 (rpsL)
    JKD6008:
    SAA6008_00551 (rpsL)
    JKD6159:
    SAA6159_00499 (rpsL)
    LGA251:
    SARLGA251_04810 (rpsL)
    M013:
    M013TW_0532
    MRSA252:
    SAR0550 (rpsL)
    MSHR1132:
    SAMSHR1132_04890
    MSSA476:
    SAS0503 (rpsL)
    Mu3:
    SAHV_0543 (rpsL)
    Mu50:
    SAV0545 (rpsL)
    MW2:
    MW0500 (rpsL)
    RF122:
    SAB0496 (rpsL)
    ST398:
    SAPIG0620 (rpsL)
    T0131:
    SAT0131_00598
    TCH60:
    HMPREF0772_12644 (rpsL)
    TW20:
    SATW20_06150 (rpsL)
    USA300_TCH1516:
    USA300HOU_0539 (rpsL)
    VC40:
    SAVC_02315 (rpsL)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPRKPNS
    N315            MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNS
    NCTC8325        MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNS
    Newman          MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNS
    USA300_FPR3757  MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNS
                    *******************************************************:****

    COL             ALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVRDLPGVRYHIVRGALDTSGV
    N315            ALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGV
    NCTC8325        ALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGV
    Newman          ALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGV
    USA300_FPR3757  ALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGV
                    ****************************************:*******************

    COL             DGRRQGRSLYGTKKPKN
    N315            DGRRQGRSLYGTKKPKN
    NCTC8325        DGRRQGRSLYGTKKPKN
    Newman          DGRRQGRSLYGTKKPKN
    USA300_FPR3757  DGRRQGRSLYGTKKPKN
                    *****************