From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002319000
  • symbol?: fusA
  • description?: elongation factor G

      descriptions from strain specific annotations:

    • elongation factor G
    • Translation elongation factor G
    • translational elongation factor G
    • protein translation elongation factor G (EF-G)
  • strand?: +
  • coordinates?: 2836512..2838659
  • synteny block?: BlockID0016180
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0593 (fusA)
    N315:
    SA0505 (fus)
    NCTC8325:
    Newman:
    NWMN_0509 (fus)
    USA300_FPR3757:
    04-02981:
    SA2981_0524 (fus)
    08BA02176:
    C248_0622 (fus)
    11819-97:
    MS7_0537 (fusA)
    71193:
    ST398NM01_0622
    ECT-R 2:
    ECTR2_501 (fusA)
    ED133:
    SAOV_0582 (fusA)
    ED98:
    SAAV_0510 (fusA)
    HO 5096 0412:
    SAEMRSA15_04740 (fus)
    JH1:
    SaurJH1_0584 (fusA)
    JH9:
    SaurJH9_0570 (fusA)
    JKD6008:
    SAA6008_00553 (fus)
    JKD6159:
    SAA6159_00501 (fus)
    LGA251:
    SARLGA251_04830 (fus)
    M013:
    M013TW_0534
    MRSA252:
    SAR0552 (fus)
    MSHR1132:
    SAMSHR1132_04910
    MSSA476:
    SAS0505 (fusA)
    Mu3:
    SAHV_0545 (fus)
    Mu50:
    SAV0547 (fus)
    MW2:
    MW0502 (fus)
    RF122:
    SAB0498 (fus)
    ST398:
    SAPIG0622 (fusA)
    T0131:
    SAT0131_00600 (hemE)
    TCH60:
    HMPREF0772_12642 (fusA)
    TW20:
    SATW20_06170 (fus)
    USA300_TCH1516:
    VC40:
    SAVC_02325

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAREFSLEKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRG
    N315            MAREFSLEKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRG
    NCTC8325        MAREFSLEKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRG
    Newman          MAREFSLEKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRG
    USA300_FPR3757  MAREFSLEKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRG
                    ************************************************************

    COL             ITITSAATTAAWEGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVW
    N315            ITITSAATTAAWEGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVW
    NCTC8325        ITITSAATTAAWEGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVW
    Newman          ITITSAATTAAWEGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVW
    USA300_FPR3757  ITITSAATTAAWEGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVW
                    ************************************************************

    COL             RQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQLPIGAEDEFEAIIDLVE
    N315            RQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQLPIGAEDEFEAIIDLVE
    NCTC8325        RQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQLPIGAEDEFEAIIDLVE
    Newman          RQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQLPIGAEDEFEAIIDLVE
    USA300_FPR3757  RQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQLPIGAEDEFEAIIDLVE
                    ************************************************************

    COL             MKCFKYTNDLGTEIEEIEIPEDHLDRAEEARASLIEAVAETSDELMEKYLGDEEISVSEL
    N315            MKCFKYTNDLGTEIEEIEIPEDHLDRAEEARASLIEAVAETSDELMEKYLGDEEISVSEL
    NCTC8325        MKCFKYTNDLGTEIEEIEIPEDHLDRAEEARASLIEAVAETSDELMEKYLGDEEISVSEL
    Newman          MKCFKYTNDLGTEIEEIEIPEDHLDRAEEARASLIEAVAETSDELMEKYLGDEEISVSEL
    USA300_FPR3757  MKCFKYTNDLGTEIEEIEIPEDHLDRAEEARASLIEAVAETSDELMEKYLGDEEISVSEL
                    ************************************************************

    COL             KEAIRQATTNVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSPLDVKPIIGHRASNPEEEVI
    N315            KEAIRQATTNVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSPLDVKPIIGHRASNPEEEVI
    NCTC8325        KEAIRQATTNVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSPLDVKPIIGHRASNPEEEVI
    Newman          KEAIRQATTNVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSPLDVKPIIGHRASNPEEEVI
    USA300_FPR3757  KEAIRQATTNVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSPLDVKPIIGHRASNPEEEVI
                    ************************************************************

    COL             AKADDSAEFAALAFKVMTDPYVGKLTFFRVYSGTMTSGSYVKNSTKGKRERVGRLLQMHA
    N315            AKADDSAEFAALAFKVMTDPYVGKLTFFRVYSGTMTSGSYVKNSTKGKRERVGRLLQMHA
    NCTC8325        AKADDSAEFAALAFKVMTDPYVGKLTFFRVYSGTMTSGSYVKNSTKGKRERVGRLLQMHA
    Newman          AKADDSAEFAALAFKVMTDPYVGKLTFFRVYSGTMTSGSYVKNSTKGKRERVGRLLQMHA
    USA300_FPR3757  AKADDSAEFAALAFKVMTDPYVGKLTFFRVYSGTMTSGSYVKNSTKGKRERVGRLLQMHA
                    ************************************************************

    COL             NSRQEIDTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQ
    N315            NSRQEIDTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQ
    NCTC8325        NSRQEIDTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQ
    Newman          NSRQEIDTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQ
    USA300_FPR3757  NSRQEIDTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQ
                    ************************************************************

    COL             DKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMV
    N315            DKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMV
    NCTC8325        DKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMV
    Newman          DKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMV
    USA300_FPR3757  DKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMV
                    ************************************************************

    COL             SYRETFKSSAQVQGKFSRQSGGRGQYGDVHIEFTPNETGAGFEFENAIVGGVVPREYIPS
    N315            SYRETFKSSAQVQGKFSRQSGGRGQYGDVHIEFTPNETGAGFEFENAIVGGVVPREYIPS
    NCTC8325        SYRETFKSSAQVQGKFSRQSGGRGQYGDVHIEFTPNETGAGFEFENAIVGGVVPREYIPS
    Newman          SYRETFKSSAQVQGKFSRQSGGRGQYGDVHIEFTPNETGAGFEFENAIVGGVVPREYIPS
    USA300_FPR3757  SYRETFKSSAQVQGKFSRQSGGRGQYGDVHIEFTPNETGAGFEFENAIVGGVVPREYIPS
                    ************************************************************

    COL             VEAGLKDAMENGVLAGYPLIDVKAKLYDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVI
    N315            VEAGLKDAMENGVLAGYPLIDVKAKLYDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVI
    NCTC8325        VEAGLKDAMENGVLAGYPLIDVKAKLYDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVI
    Newman          VEAGLKDAMENGVLAGYPLIDVKAKLYDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVI
    USA300_FPR3757  VEAGLKDAMENGVLAGYPLIDVKAKLYDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVI
                    ************************************************************

    COL             LEPMMKVTIEMPEEYMGDIMGDVTSRRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSLRS
    N315            LEPMMKVTIEMPEEYMGDIMGDVTSRRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSLRS
    NCTC8325        LEPMMKVTIEMPEEYMGDIMGDVTSRRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSLRS
    Newman          LEPMMKVTIEMPEEYMGDIMGDVTSRRGRVDGMEPRGNAQVVNAYVPLSEMLGYATSLRS
    USA300_FPR3757  LEPMMKVTIEMPEEYMGDIMGDVTSRRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSLRS
                    ***************************************************:********

    COL             NTQGRGTYTMYFDHYAEVPKSIAEDIIKKNKGE
    N315            NTQGRGTYTMYFDHYAEVPKSIAEDIIKKNKGE
    NCTC8325        NTQGRGTYTMYFDHYAEVPKSIAEDIIKKNKGE
    Newman          HTQGRGTYTMYFDHYAEIPKSIAEDIIKKNKGE
    USA300_FPR3757  NTQGRGTYTMYFDHYAEVPKSIAEDIIKKNKGE
                    :****************:***************