From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002320000
  • symbol?: tuf
  • description?: elongation factor Tu

      descriptions from strain specific annotations:

    • elongation factor Tu
    • Translation elongation factor Tu
    • translational elongation factor TU
    • protein translation elongation factor Tu (EF-TU)
    • elongation factor EF1A
  • strand?: +
  • coordinates?: 2838878..2840062
  • synteny block?: BlockID0016190
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0594 (tuf)
    N315:
    SA0506 (tuf)
    NCTC8325:
    Newman:
    NWMN_0510 (tufA)
    USA300_FPR3757:
    04-02981:
    SA2981_0525 (tufA)
    08BA02176:
    C248_0623 (tuf)
    11819-97:
    MS7_0538 (tuf)
    71193:
    ST398NM01_0623
    ECT-R 2:
    ECTR2_502 (tuf)
    ED133:
    SAOV_0583 (tuf)
    ED98:
    SAAV_0511 (tuf)
    HO 5096 0412:
    SAEMRSA15_04750 (tuf)
    JH1:
    SaurJH1_0585 (tuf)
    JH9:
    SaurJH9_0571 (tuf)
    JKD6008:
    SAA6008_00554 (tuf)
    JKD6159:
    SAA6159_00502 (tuf)
    LGA251:
    SARLGA251_04840 (tuf)
    M013:
    M013TW_0535
    MRSA252:
    SAR0553 (tuf)
    MSHR1132:
    SAMSHR1132_04920
    MSSA476:
    SAS0506 (tuf)
    Mu3:
    SAHV_0546 (tufA)
    Mu50:
    SAV0548 (tuf)
    MW2:
    MW0503 (tuf)
    RF122:
    SAB0499 (tuf)
    ST398:
    SAPIG0623 (tuf)
    T0131:
    SAT0131_00601
    TCH60:
    HMPREF0772_12641 (tuf)
    TW20:
    SATW20_06180 (tuf)
    USA300_TCH1516:
    USA300HOU_0541 (tufA)
    VC40:
    SAVC_02330

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKEKFDRSKEHANIGTIGHVDHGKTTLTAAIATVLAKNGDSVAQSYDMIDNAPEEKERG
    N315            MAKEKFDRSKEHANIGTIGHVDHGKTTLTAAIATVLAKNGDSVAQSYDMIDNAPEEKERG
    NCTC8325        MAKEKFDRSKEHANIGTIGHVDHGKTTLTAAIATVLAKNGDSVAQSYDMIDNAPEEKERG
    Newman          MAKEKFDRSKEHANIGTIGHVDHGKTTLTAAIATVLAKNGDSVAQSYDMIDNAPEEKERG
    USA300_FPR3757  MAKEKFDRSKEHANIGTIGHVDHGKTTLTAAIATVLAKNGDSVAQSYDMIDNAPEEKERG
                    ************************************************************

    COL             ITINTSHIEYQTDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
    N315            ITINTSHIEYQTDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
    NCTC8325        ITINTSHIEYQTDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
    Newman          ITINTSHIEYQTDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
    USA300_FPR3757  ITINTSHIEYQTDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
                    ************************************************************

    COL             LLSRNVGVPALVVFLNKVDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIAGSALKALE
    N315            LLSRNVGVPALVVFLNKVDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIAGSALKALE
    NCTC8325        LLSRNVGVPALVVFLNKVDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIAGSALKALE
    Newman          LLSRNVGVPALVVFLNKVDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIAGSALKALE
    USA300_FPR3757  LLSRNVGVPALVVFLNKVDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIAGSALKALE
                    ************************************************************

    COL             GDAQYEEKILELMEAVDTYIPTPERDSDKPFMMPVEDVFSITGRGTVATGRVERGQIKVG
    N315            GDAQYEEKILELMEAVDTYIPTPERDSDKPFMMPVEDVFSITGRGTVATGRVERGQIKVG
    NCTC8325        GDAQYEEKILELMEAVDTYIPTPERDSDKPFMMPVEDVFSITGRGTVATGRVERGQIKVG
    Newman          GDAQYEEKILELMEAVDTYIPTPERDSDKPFMMPVEDVFSITGRGTVATGRVERGQIKVG
    USA300_FPR3757  GDAQYEEKILELMEAVDTYIPTPERDSDKPFMMPVEDVFSITGRGTVATGRVERGQIKVG
                    ************************************************************

    COL             EEVEIIGLHDTSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDVQRGQVLAAPGSIT
    N315            EEVEIIGLHDTSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDVQRGQVLAAPGSIT
    NCTC8325        EEVEIIGLHDTSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDVQRGQVLAAPGSIT
    Newman          EEVEIIGLHDTSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDVQRGQVLAAPGSIT
    USA300_FPR3757  EEVEIIGLHDTSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDVQRGQVLAAPGSIT
                    ************************************************************

    COL             PHTEFKAEVYVLSKDEGGRHTPFFSNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNVEMT
    N315            PHTEFKAEVYVLSKDEGGRHTPFFSNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNVEMT
    NCTC8325        PHTEFKAEVYVLSKDEGGRHTPFFSNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNVEMT
    Newman          PHTEFKAEVYVLSKDEGGRHTPFFSNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNVEMT
    USA300_FPR3757  PHTEFKAEVYVLSKDEGGRHTPFFSNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNVEMT
                    ************************************************************

    COL             VELIAPIAIEDGTRFSIREGGRTVGSGVVTEIIK
    N315            VELIAPIAIEDGTRFSIREGGRTVGSGVVTEIIK
    NCTC8325        VELIAPIAIEDGTRFSIREGGRTVGSGVVTEIIK
    Newman          VELIAPIAIEDGTRFSIREGGRTVGSGVVTEIIK
    USA300_FPR3757  VELIAPIAIEDGTRFSIREGGRTVGSGVVTEIIK
                    **********************************