From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002325000
  • symbol?:
  • description?: UDP-glucose 4-epimerase-like protein

      descriptions from strain specific annotations:

    • UDP-glucose 4-epimerase-like protein
    • NAD-dependent epimerase/dehydratase
    • L-threonine 3-dehydrogenase
    • NAD dependent epimerase/dehydratase family protein
    • polysaccharide biosynthesis family protein
    • polysaccharide biosynthesis protein CapD
    • epimerase/reductase, putative
  • strand?: +
  • coordinates?: 2846172..2847206
  • synteny block?: BlockID0016240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0515 (capD)
    USA300_FPR3757:
    04-02981:
    SA2981_0530
    08BA02176:
    C248_0628
    11819-97:
    MS7_0543
    71193:
    ST398NM01_0628
    ECT-R 2:
    ECTR2_507
    ED133:
    SAOV_0588
    ED98:
    SAAV_0516
    HO 5096 0412:
    SAEMRSA15_04800
    JH1:
    SaurJH1_0590
    JH9:
    SaurJH9_0576
    JKD6008:
    SAA6008_00559 (capD)
    JKD6159:
    SAA6159_00507 (capD)
    LGA251:
    SARLGA251_04890
    M013:
    M013TW_0540
    MRSA252:
    SAR0558
    MSHR1132:
    SAMSHR1132_04970
    MSSA476:
    SAS0511
    Mu3:
    SAHV_0551
    Mu50:
    SAV0553
    MW2:
    MW0508
    RF122:
    SAB0504
    ST398:
    SAPIG0628
    T0131:
    SAT0131_00606
    TCH60:
    HMPREF0772_12636 (tdh)
    TW20:
    SATW20_06230
    USA300_TCH1516:
    USA300HOU_0546
    VC40:
    SAVC_02355

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKIMITGALGQIGTELVVKCREIYGTDNVLATDIREPEADSPVQNGPFEILDVTDRDRM
    N315            MKKIMITGALGQIGTELVVKCREIYGTDNVLATDIREPEADSPVQNGPFEILDVTDRDRM
    NCTC8325        MKKIMITGALGQIGTELVVKCREIYGTDNVLATDIREPEADSPVQNGPFEILDVTDRDRM
    Newman          MKKIMITGALGQIGTELVVKCREIYGTDNVLATDIREPEADSPVQNGPFEILDVTDRDRM
    USA300_FPR3757  MKKIMITGALGQIGTELVVKCREIYGTDNVLATDIREPEADSPVQNGPFEILDVTDRDRM
                    ************************************************************

    COL             FELVRDFEADSLMHMAALLSATAEKNPILAWDLNMGGLMNALEAARTYNLHFFTPSSIGA
    N315            FELVRDFEADSLMHMAALLSATAEKNPILAWDLNMGGLMNALEAARTYNLHFFTPSSIGA
    NCTC8325        FELVRDFEADSLMHMAALLSATAEKNPILAWDLNMGGLMNALEAARTYNLHFFTPSSIGA
    Newman          FELVRDFEADSLMHMAALLSATAEKNPILAWDLNMGGLMNALEAARTYNLHFFTPSSIGA
    USA300_FPR3757  FELVRDFEADSLMHMAALLSATAEKNPILAWDLNMGGLMNALEAARTYNLHFFTPSSIGA
                    ************************************************************

    COL             FGDSTPKVNTPQVTIQQPTTMYGVNKVAGELLCQYYFKRFGVDTRSVRFPGLISHVKEPG
    N315            FGDSTPKVNTPQVTIQQPTTMYGVNKVAGELLCQYYFKRFGVDTRSVRFPGLISHVKEPG
    NCTC8325        FGDSTPKVNTPQVTIQQPTTMYGVNKVAGELLCQYYFKRFGVDTRSVRFPGLISHVKEPG
    Newman          FGDSTPKVNTPQVTIQQPTTMYGVNKVAGELLCQYYFKRFGVDTRSVRFPGLISHVKEPG
    USA300_FPR3757  FGDSTPKVNTPQVTIQQPTTMYGVNKVAGELLCQYYFKRFGVDTRSVRFPGLISHVKEPG
                    ************************************************************

    COL             GGTTDYAVEIYFKAVREGHYTSFIDKGTYMDMMYMDDAIEAIIKLMEADDAKLETRNGYN
    N315            GGTTDYAVEIYFKAVREGHYTSFIDKGTYMDMMYMDDAIEAIIKLMEADDAKLETRNGYN
    NCTC8325        GGTTDYAVEIYFKAVREGHYTSFIDKGTYMDMMYMDDAIEAIIKLMEADDAKLETRNGYN
    Newman          GGTTDYAVEIYFKAVREGHYTSFIDKGTYMDMMYMDDAIEAIIKLMEADDAKLETRNGYN
    USA300_FPR3757  GGTTDYAVEIYFKAVREGHYTSFIDKGTYMDMMYMDDAIEAIIKLMEADDAKLETRNGYN
                    ************************************************************

    COL             LSAMSFDPEMVKEAIQEYYPNFTLDYDVDPIRQGIANSWPDSIDTSCSRGEWGFDPKYDL
    N315            LSAMSFDPEMVKEAIQEYYPNFTLDYDVDPIRQGIANSWPDSIDTSCSRGEWGFDPKYDL
    NCTC8325        LSAMSFDPEMVKEAIQEYYPNFTLDYDVDPIRQGIANSWPDSIDTSCSRGEWGFDPKYDL
    Newman          LSAMSFDPEMVKEAIQEYYPNFTLDYDVDPIRQGIANSWPDSIDTSCSRGEWGFDPKYDL
    USA300_FPR3757  LSAMSFDPEMVKEAIQEYYPNFTLDYDVDPIRQGIANSWPDSIDTSCSRGEWGFDPKYDL
                    ************************************************************

    COL             ASMTKLMLEAIEQKDTVKNNN
    N315            ASMTKLMLEAIEQKDTVKNNN
    NCTC8325        ASMTKLMLEAIEQKDTVKNNN
    Newman          ASMTKLMLEAIEQKDTVKNNN
    USA300_FPR3757  ASMTKLMLEAIEQKDTVKNNN
                    *********************