From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002326000
  • symbol?: ilvE
  • description?: branched-chain amino acid aminotransferase

      descriptions from strain specific annotations:

    • branched-chain amino acid aminotransferase
    • putative aminotransferase
    • branched-chain-amino-acid transaminase
  • strand?: +
  • coordinates?: 2847542..2848618
  • synteny block?: BlockID0016250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0600 (ilvE)
    N315:
    SA0512 (ilvE)
    NCTC8325:
    Newman:
    NWMN_0516 (ilvE)
    USA300_FPR3757:
    04-02981:
    SA2981_0531 (ilvE)
    08BA02176:
    C248_0629
    11819-97:
    MS7_0544 (ilvE)
    71193:
    ST398NM01_0629
    ECT-R 2:
    ECTR2_508 (ilvE)
    ED133:
    SAOV_0589 (ilvE)
    ED98:
    SAAV_0517 (ilvE)
    HO 5096 0412:
    SAEMRSA15_04810
    JH1:
    SaurJH1_0591
    JH9:
    SaurJH9_0577
    JKD6008:
    SAA6008_00560 (ilvE)
    JKD6159:
    SAA6159_00508 (ilvE)
    LGA251:
    SARLGA251_04900
    M013:
    M013TW_0541
    MRSA252:
    SAR0559
    MSHR1132:
    SAMSHR1132_04980
    MSSA476:
    SAS0512
    Mu3:
    SAHV_0552 (ilvE)
    Mu50:
    SAV0554 (ilvE)
    MW2:
    MW0509 (ilvE)
    RF122:
    SAB0505
    ST398:
    SAPIG0629 (ilvE)
    T0131:
    SAT0131_00607
    TCH60:
    HMPREF0772_12635 (ilvE)
    TW20:
    SATW20_06240
    USA300_TCH1516:
    USA300HOU_0547 (ilvE)
    VC40:
    SAVC_02360

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQAVKVERRETLKQKPNTSQLGFGKYFTDYMLSYDYDADKGWHDLKIVPYGPIEISPAA
    N315            MSQAVKVERRETLKQKPNTSQLGFGKYFTDYMLSYDYDADKGWHDLKIVPYGPIEISPAA
    NCTC8325        MSQAVKVERRETLKQKPNTSQLGFGKYFTDYMLSYDYDADKGWHDLKIVPYGPIEISPAA
    Newman          MSQAVKVERRETLKQKPNTSQLGFGKYFTDYMLSYDYDADKGWHDLKIVPYGPIEISPAA
    USA300_FPR3757  MSQAVKVERRETLKQKPNTSQLGFGKYFTDYMLSYDYDADKGWHDLKIVPYGPIEISPAA
                    ************************************************************

    COL             QGVHYGQSVFEGLKAYKRDGEVALFRPEENFKRLNNSLARLEMPQVDEAELLEGLKQLVD
    N315            QGVHYGQSVFEGLKAYKRDGEVALFRPEENFKRLNNSLARLEMPQVDEAELLEGLKQLVD
    NCTC8325        QGVHYGQSVFEGLKAYKRDGEVALFRPEENFKRLNNSLARLEMPQVDEAELLEGLKQLVD
    Newman          QGVHYGQSVFEGLKAYKRDGEVALFRPEENFKRLNNSLARLEMPQVDEAELLEGLKQLVD
    USA300_FPR3757  QGVHYGQSVFEGLKAYKRDGEVALFRPEENFKRLNNSLARLEMPQVDEAELLEGLKQLVD
                    ************************************************************

    COL             IERDWIPEGEGQSLYIRPFVFATEGALGVGASHQYKLLIILSPSGAYYGGETLKPTKIYV
    N315            IERDWIPEGEGQSLYIRPFVFATEGALGVGASHQYKLLIILSPSGAYYGGETLKPTKIYV
    NCTC8325        IERDWIPEGEGQSLYIRPFVFATEGALGVGASHQYKLLIILSPSGAYYGGETLKPTKIYV
    Newman          IERDWIPEGEGQSLYIRPFVFATEGALGVGASHQYKLLIILSPSGAYYGGETLKPTKIYV
    USA300_FPR3757  IERDWIPEGEGQSLYIRPFVFATEGALGVGASHQYKLLIILSPSGAYYGGETLKPTKIYV
                    ************************************************************

    COL             EDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWLDGVEQKYIEEVGSMNIFF
    N315            EDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWLDGVEQKYIEEVGSMNIFF
    NCTC8325        EDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWLDGVEQKYIEEVGSMNIFF
    Newman          EDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWLDGVEQKYIEEVGSMNIFF
    USA300_FPR3757  EDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWLDGVEQKYIEEVGSMNIFF
                    ************************************************************

    COL             VENGKVITPELNGSILPGITRKSIIELAKNLGYEVEERRVSIDELFESYDKGELTEVFGS
    N315            VENGKVITPELNGSILPGITRKSIIELAKNLGYEVEERRVSIDELFESYDKGELTEVFGS
    NCTC8325        VENGKVITPELNGSILPGITRKSIIELAKNLGYEVEERRVSIDELFESYDKGELTEVFGS
    Newman          VENGKVITPELNGSILPGITRKSIIELAKNLGYEVEERRVSIDELFESYDKGELTEVFGS
    USA300_FPR3757  VENGKVITPELNGSILPGITRKSIIELAKNLGYEVEERRVSIDELFESYDKGELTEVFGS
                    ************************************************************

    COL             GTAAVISPVGTLRYEDREIVINNNETGEITQKLYDVYTGIQNGTLEDKNGWRVVVPKY
    N315            GTAAVISPVGTLRYEDREIVINNNETGEITQKLYDVYTGIQNGTLEDKNGWRVVVPKY
    NCTC8325        GTAAVISPVGTLRYEDREIVINNNETGEITQKLYDVYTGIQNGTLEDKNGWRVVVPKY
    Newman          GTAAVISPVGTLRYEDREIVINNNETGEITQKLYDVYTGIQNGTLEDKNGWRVVVPKY
    USA300_FPR3757  GTAAVISPVGTLRYEDREIVINNNETGEITQKLYDVYTGIQNGTLEDKNGWRVVVPKY
                    **********************************************************