From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002332000
  • symbol?:
  • description?: cof family hydrolase

      descriptions from strain specific annotations:

    • cof family hydrolase
    • HAD superfamily hydrolase
    • Hydrolase (HAD superfamily)
    • cof-like hydrolase family protein
    • putative haloacid dehalogenase-like hydrolase
    • hydrolase, haloacid dehalogenase-like protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • hydrolase, HAD superfamily
    • haloacid dehalogenase-like family hydrolase
  • strand?: +
  • coordinates?: 2851632..2852501
  • synteny block?: BlockID0016310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0536
    08BA02176:
    C248_0634
    11819-97:
    MS7_0549
    71193:
    ST398NM01_0634
    ECT-R 2:
    ECTR2_513
    ED133:
    SAOV_0594
    ED98:
    SAAV_0522
    HO 5096 0412:
    SAEMRSA15_04860
    JH1:
    SaurJH1_0596
    JH9:
    SaurJH9_0582
    JKD6008:
    SAA6008_00566
    JKD6159:
    SAA6159_00513
    LGA251:
    SARLGA251_04950
    M013:
    M013TW_0546
    MRSA252:
    SAR0564
    MSHR1132:
    SAMSHR1132_05030
    MSSA476:
    SAS0517
    Mu3:
    SAHV_0557
    Mu50:
    SAV0559
    MW2:
    MW0514
    RF122:
    SAB0510
    ST398:
    SAPIG0634
    T0131:
    SAT0131_00613
    TCH60:
    HMPREF0772_12630
    TW20:
    SATW20_06290
    USA300_TCH1516:
    USA300HOU_0553
    VC40:
    SAVC_02390

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKLIATDMDGTLLNAAHEISQPNIDAIKYAQEQGITVVIATGRAFYEAQAPVADTDLTV
    N315            MIKLIATDMDGTLLNAAHEISQPNIDAIKYAQEQGITVVIATGRAFYEAQAPVADTDLTV
    NCTC8325        MIKLIATDMDGTLLNAAHEISQPNIDAIKYAQEQGITVVIATGRAFYEAQAPVADTDLTV
    Newman          MIKLIATDMDGTLLNAAHEISQPNIDAIKYAQEQGITVVIATGRAFYEAQAPVADTDLTV
    USA300_FPR3757  MIKLIATDMDGTLLNAAHEISQPNIDAIKYAQEQGITVVIATGRAFYEAQAPVADTDLTV
                    ************************************************************

    COL             PYICLNGAEVRDETFNVMSTSHLNKSLVHKITNVLKDAGIYYQVYTSRAIYTEDPQRDLD
    N315            PYICLNGAEVRDETFNVMSTSHLNKSLVHKITNVLKDAGIYYQVYTSRAIYTEDPQRDLD
    NCTC8325        PYICLNGAEVRDETFNVMSTSHLNKSLVHKITNVLKDAGIYYQVYTSRAIYTEDPQRDLD
    Newman          PYICLNGAEVRDETFNVMSTSHLNKSLVHKITNVLKDAGIYYQVYTSRAIYTEDPQRDLD
    USA300_FPR3757  PYICLNGAEVRDETFNVMSTSHLNKSLVHKITNVLKDAGIYYQVYTSRAIYTEDPQRDLD
                    ************************************************************

    COL             IYIDIAERAGQHANVERIKNGIQRRIDNGTLKVVDNYDAIENIPGELIMKILAFDGNLEK
    N315            IYIDIAERAGQHANVERIKNGIQRRIDNGTLKVVDNYDAIENIPGELIMKILAFDGNLEK
    NCTC8325        IYIDIAERAGQHANVERIKNGIQRRIDNGTLKVVDNYDAIENIPGELIMKILAFDGNLEK
    Newman          IYIDIAERAGQHANVERIKNGIQRRIDNGTLKVVDNYDAIENIPGELIMKILAFDGNLEK
    USA300_FPR3757  IYIDIAERAGQHANVERIKNGIQRRIDNGTLKVVDNYDAIENIPGELIMKILAFDGNLEK
                    ************************************************************

    COL             IDKASKILAESPNLAISSSSRGNIEITHSDAQKGIALETIAERLGIEMKEVMSIGDNLND
    N315            IDKASKILAESPNLAISSSSRGNIEITHSDAQKGIALETIAERLGIEMKDVMAIGDNLND
    NCTC8325        IDKASKILAESPNLAISSSSRGNIEITHSDAQKGIALETIAERLGIEMKEVMSIGDNLND
    Newman          IDKASKILAESPNLAISSSSRGNIEITHSDAQKGIALETIAERLGIEMKEVMSIGDNLND
    USA300_FPR3757  IDKASKILAESPNLAISSSSRGNIEITHSDAQKGIALETIAERLGIEMKEVMSIGDNLND
                    *************************************************:**:*******

    COL             LSMLEKVGYPVAMENGAEEVKKIAKYVTDTNENSGVGKAIMKLLREQQV
    N315            LSMLEKVGYPVAMENGAEEVKKIAKYVTDTNENSGVGKAIMKLLREQQV
    NCTC8325        LSMLEKVGYPVAMENGAEEVKKIAKYVTDTNENSGVGKAIMKLLREQQV
    Newman          LSMLEKVGYPVAMENGAEEVKKIAKYVTDTNENSGVGKAIMKLLREQQV
    USA300_FPR3757  LSMLEKVGYPVAMENGAEEVKKIAKYVTDTNENSGVGKAIMKLLREQQV
                    *************************************************