From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002335000
  • symbol?: sdrC
  • description?: Ser-Asp rich fibrinogen-binding, bone sialoprotein-binding protein

      descriptions from strain specific annotations:

    • Ser-Asp rich fibrinogen-binding, bone sialoprotein-binding protein
    • Adhesin of unknown specificity SdrC
    • cell wall anchor domain-containing protein
    • sdrC protein
    • LPXTG-motif cell wall anchor domain-containing protein
    • putative surface anchored protein
    • Ser-Asp rich fibrinogen-binding bone sialoprotein-binding protein
    • serine-aspartate repeat-containing protein C
    • Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrC
    • pseudogene
    • Fibronectin-binding protein
    • adhesin SdrC
  • strand?: +
  • coordinates?: 2853568..2857378
  • synteny block?: BlockID0016340
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0608 (sdrC)
    N315:
    SA0519 (sdrC)
    NCTC8325:
    Newman:
    NWMN_0523 (sdrC)
    USA300_FPR3757:
    04-02981:
    SA2981_0538 (sdrC)
    08BA02176:
    C248_0636 (sdrC)
    11819-97:
    MS7_0551 (sdrC)
    71193:
    ST398NM01_0636
    ECT-R 2:
    ECTR2_515
    ED133:
    SAOV_0596 (sdrC)
    ED98:
    SAAV_0524 (sdrC)
    HO 5096 0412:
    SAEMRSA15_04880 (sdrC)
    JH1:
    SaurJH1_0598
    JH9:
    SaurJH9_0584
    JKD6008:
    SAA6008_00568 (sdrC)
    JKD6159:
    SAA6159_00515 (sdrC)
    LGA251:
    SARLGA251_04970 (sdrC)
    M013:
    M013TW_0548
    MRSA252:
    SAR0566 (sdrC)
    MSHR1132:
    MSSA476:
    SAS0519
    Mu3:
    SAHV_0559 (sdrC)
    Mu50:
    SAV0561 (sdrC)
    MW2:
    MW0516 (sdrC)
    RF122:
    SAB0512 (sdrC)
    ST398:
    SAPIG0636
    T0131:
    SAT0131_00617
    TCH60:
    HMPREF0772_12628 (sdrC)
    TW20:
    SATW20_06310 (sdrC)
    USA300_TCH1516:
    USA300HOU_0555 (sdrC)
    VC40:
    SAVC_02400

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNKKTATNRKGMIPNRLNKFSIRKYSVGTASILVGTTLIFGLSGHEAKAAEHTNGELNQ
    N315            MNNKKTATNRKGMIPNRLNKFSIRKYSVGTASILVGTTLIFGLSGHEAKAAEHTNGELNQ
    NCTC8325        MNNKKTATNRKGMIPNRLNKFSIRKYSVGTASILVGTTLIFGLSGHEAKAAEHTNGELNQ
    Newman          MNNKKTATNRKGMIPNRLNKFSIRKYSVGTASILVGTTLIFGLSGHEAKAAEHTNGELNQ
    USA300_FPR3757  MNNKKTATNRKGMIPNRLNKFSIRKYSVGTASILVGTTLIFGLSGHEAKAAEHTNGELNQ
                    ************************************************************

    COL             SKNETTAPSENKTTKKVDSRQLKDNTQTATADQPKVTMSDSATVKETSSNMQSPQNATAN
    N315            SKNETTAPSENKTTEKVDSRQLKDNTQTATADQPKVTMSDSATVKETSSNMQSPQNATAS
    NCTC8325        SKNETTAPSENKTTKKVDSRQLKDNTQTATADQPKVTMSDSATVKETSSNMQSPQNATAN
    Newman          SKNETTAPSENKTTKKVDSRQLKDNTQTATADQPKVTMSDSATVKETSSNMQSPQNATAN
    USA300_FPR3757  SKNETTAPSENKTTKKVDSRQLKDNTQTATADQPKVTMSDSATVKETSSNMQSPQNATAN
                    **************:********************************************.

    COL             QSTTKTSNVTTNDKSSTTYSNETDKSNLTQAKDVSTTPKTTTIKPRTLNRMAVNTVAAPQ
    N315            QSTTQTSNVTTNDKSSTTYSNETDKSNLTQAKNVSTTPKTTTIKQRALNRMAVNTVAAPQ
    NCTC8325        QSTTKTSNVTTNDKSSTTYSNETDKSNLTQAKDVSTTPKTTTIKPRTLNRMAVNTVAAPQ
    Newman          QSTTKTSNVTTNDKSSTTYSNETDKSNLTQAKDVSTTPKTTTIKPRTLNRMAVNTVAAPQ
    USA300_FPR3757  QSTTKTSNVTTNDKSSTTYSNETDKSNLTQAKDVSTTPKTTTIKPRTLNRMAVNTVAAPQ
                    ****:***************************:*********** *:*************

    COL             QGTNVNDKVHFSNIDIAIDKGHVNQTTGKTEFWATSSDVLKLKANYTIDDSVKEGDTFTF
    N315            QGTNVNDKVHFTNIDIAIDKGHVNKTTGNTEFWATSSDVLKLKANYTIDDSVKEGDTFTF
    NCTC8325        QGTNVNDKVHFSNIDIAIDKGHVNQTTGKTEFWATSSDVLKLKANYTIDDSVKEGDTFTF
    Newman          QGTNVNDKVHFSNIDIAIDKGHVNQTTGKTEFWATSSDVLKLKANYTIDDSVKEGDTFTF
    USA300_FPR3757  QGTNVNDKVHFSNIDIAIDKGHVNQTTGKTEFWATSSDVLKLKANYTIDDSVKEGDIFTF
                    ***********:************:***:*************************** ***

    COL             KYGQYFRPGSVRLPSQTQNLYNAQGNIIAKGIYDSTTNTTTYTFTNYVDQYTNVRGSFEQ
    N315            KYGQYFRPGSVRLPSQTQNLYNAQGNIIAKGIYDSKTNTTTYTFTNYVDQYTNVSGSFEQ
    NCTC8325        KYGQYFRPGSVRLPSQTQNLYNAQGNIIAKGIYDSTTNTTTYTFTNYVDQYTNVRGSFEQ
    Newman          KYGQYFRPGSVRLPSQTQNLYNAQGNIIAKGIYDSTTNTTTYTFTNYVDQYTNVRGSFEQ
    USA300_FPR3757  KYGQYFRPGSVRLPSQTQNLYNAQGNIIAKGIYDSTTNTTTYTFTNYVDQYTNVRGSFEQ
                    ***********************************.****************** *****

    COL             VAFAKRKNATTDKTAYKMEVTLGNDTYSEEIIVDYGNKKAQPLISSTNYINNEDLSRNMT
    N315            VAFAKRENATTDKTAYKMEVTLGNDTYSKDVIVDYGNQKGQQLISSTNYINNEDLSRNMT
    NCTC8325        VAFAKRKNATTDKTAYKMEVTLGNDTYSEEIIVDYGNKKAQPLISSTNYINNEDLSRNMT
    Newman          VAFAKRKNATTDKTAYKMEVTLGNDTYSEEIIVDYGNKKAQPLISSTNYINNEDLSRNMT
    USA300_FPR3757  VAFAKRKNATTDKTAYKMEVTLGNDTYSEEIIVDYGNKKAQPLISSTNYINNEDLSRNMT
                    ******:*********************:::******:*.* ******************

    COL             AYVNQPKNTYTKQTFVTNLTGYKFNPNAKNFKIYEVTDQNQFVDSFTPDTSKLKDVTDQF
    N315            VYVNQPKKTYTKETFVTNLTGYKFNPDAKNFKIYEVTDQNQFVDSFTPDTSKLKDVTGQF
    NCTC8325        AYVNQPKNTYTKQTFVTNLTGYKFNPNAKNFKIYEVTDQNQFVDSFTPDTSKLKDVTDQF
    Newman          AYVNQPKNTYTKQTFVTNLTGYKFNPNAKNFKIYEVTDQNQFVDSFTPDTSKLKDVTDQF
    USA300_FPR3757  AYVNQPKNTYTKQTFVTNLTGYKFNPNAKNFKIYEVTDQNQFVDSFTPDTSKLKDVTDQF
                    .******:****:*************:******************************.**

    COL             DVIYSNDNKTATVDLMKGQTSSNKQYIIQQVAYPDNSSTDNGKIDYTLDTDKTKYSWSNS
    N315            DVIYSNDNKTATVDLLNGQSSSDKQYIIQQVAYPDNSSTDNGKIDYTLETQNGKSSWSNS
    NCTC8325        DVIYSNDNKTATVDLMKGQTSSNKQYIIQQVAYPDNSSTDNGKIDYTLDTDKTKYSWSNS
    Newman          DVIYSNDNKTATVDLMKGQTSSNKQYIIQQVAYPDNSSTDNGKIDYTLDTDKTKYSWSNS
    USA300_FPR3757  DVIYSNDNKTATVDLMKGQTSSNKQYIIQQVAYPDNSSTDNGKIDYTLDTDKTKYSWSNS
                    ***************::**:**:*************************:*:: * *****

    COL             YSNVNGSSTANGDQKKYNLGDYVWEDTNKDGKQDANEKGIKGVYVILKDSNGKELDRTTT
    N315            YSNVNGSSTANGDQKKYNLGDYVWEDTNKDGKQDANEKGIKGVYVILKDSNGKELDRTTT
    NCTC8325        YSNVNGSSTANGDQKKYNLGDYVWEDTNKDGKQDANEKGIKGVYVILKDSNGKELDRTTT
    Newman          YSNVNGSSTANGDQKKYNLGDYVWEDTNKDGKQDANEKGIKGVYVILKDSNGKELDRTTT
    USA300_FPR3757  YSNVNGSSTANGDQKKYNLGDYVWEDTNKDGKQDANEKGIKGVYVILKDSNGKELDRTTT
                    ************************************************************

    COL             DENGKYQFTGLSNGTYSVEFSTPAGYTPTTANVGTDDAVDSDGLTTTGVIKDADNMTLDS
    N315            DENGKYQFTGLSNGTYSVEFSTPAGYTPTTANAGTDDAVDSDGLTTTGVIKDADNMTLDS
    NCTC8325        DENGKYQFTGLSNGTYSVEFSTPAGYTPTTANVGTDDAVDSDGLTTTGVIKDADNMTLDS
    Newman          DENGKYQFTGLSNGTYSVEFSTPAGYTPTTANVGTDDAVDSDGLTTTGVIKDADNMTLDS
    USA300_FPR3757  DENGKYQFTGLSNGTYSVEFSTPAGYTPTTANVGTDDAVDSDGLTTTGVIKDADNMTLDS
                    ********************************.***************************

    COL             GFYKTPKYSLGDYVWYDSNKDGKQDSTEKGIKGVKVTLQNEKGEVIGTTETDENGKYRFD
    N315            GFYKTPKYSLGDYVWYDSNKDGKQDSTEKGIKGVKVTLQNEKGEVIGTTETDENGKYRFD
    NCTC8325        GFYKTPKYSLGDYVWYDSNKDGKQDSTEKGIKGVKVTLQNEKGEVIGTTETDENGKYRFD
    Newman          GFYKTPKYSLGDYVWYDSNKDGKQDSTEKGIKGVKVTLQNEKGEVIGTTETDENGKYRFD
    USA300_FPR3757  GFYKTPKYSLGDYVWYDSNKDGKQDSTEKGIKGVKVTLQNEKGEVIGTTETDENGKYRFD
                    ************************************************************

    COL             NLDSGKYKVIFEKPAGLTQTGTNTTEDDKDADGGEVDVTITDHDDFTLDNGYYEEETSDS
    N315            NLDSGKYKVIFEKPAGLTQTGTNTTEDDKDADGGEVDVTITDHDDFTLDNGYYEEETSDS
    NCTC8325        NLDSGKYKVIFEKPAGLTQTGTNTTEDDKDADGGEVDVTITDHDDFTLDNGYYEEETSDS
    Newman          NLDSGKYKVIFEKPAGLTQTGTNTTEDDKDADGGEVDVTITDHDDFTLDNGYYEEETSDS
    USA300_FPR3757  NLDSGKYKVIFEKPAGLTQTGTNTTEDDKDADGGEVDVTITDHDDFTLDNGYYEEETSDS
                    ************************************************************

    COL             DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD------SDSDSDS
    N315            DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDS
    NCTC8325        DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD------SDSDSDS
    Newman          DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSN------SDSDSDS
    USA300_FPR3757  DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD------SDSDSDS
                    **********************************************:      *******

    COL             DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS------------------------
    N315            DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS------------------------
    NCTC8325        DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    Newman          DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS------------------------
    USA300_FPR3757  DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS------------------------
                    ************************************                        

    COL             ------------------------DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    N315            ------------------------DSDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    NCTC8325        DSDSDSDSDSDSDSDSDSDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    Newman          ------------------------DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    USA300_FPR3757  ------------------------DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
                                            *******.****************************

    COL             DSDSDSDSDSDSDSDSDSDSDSDSDSDSDNDSDSDSDSDSDAGKHTPAKPMSTVKDQHKT
    N315            DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDAGKHTPTKPMSTVKDQHKT
    NCTC8325        DSDSDSDSDSDSDSDSDSDSDSDSDSDSDNDSDSDSDSDSDAGKHTPAKPMSTVKDQHKT
    Newman          DSDSDSDSDSDSDSDSDSDSDSDSDSDSDNDSDSDSDSDSDAGKHTPAKPMSTVKDQHKT
    USA300_FPR3757  DSDSDSDSDSDSDSDSDSDSDSDSDSDSDNDSDSDSDSDSDAGKHTPAKPMSTVKDQHKT
                    *****************************.*****************:************

    COL             AKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
    N315            AKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
    NCTC8325        AKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
    Newman          AKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
    USA300_FPR3757  AKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK
                    *****************************************