From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002353000
  • symbol?: vraB
  • description?: acetyl-CoA acetyltransferase

      descriptions from strain specific annotations:

    • acetyl-CoA acetyltransferase
    • acetyl-CoA c-acetyltransferase
    • acetyl-CoA C-acetyltransferase VraB
    • 3-ketoacyl-CoA thiolase
    • acetyl-CoA acetyltransferases family protein
    • acetyl-CoA C-acetyltransferase family protein
    • ketoacyl-CoA thiolase
    • Putative acetyl-CoA C-acetyltransferase vraB
    • putative ketoacyl-CoA thiolase
  • strand?: +
  • coordinates?: 2892999..2894150
  • synteny block?: BlockID0016520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0622 (atoB)
    N315:
    SA0534 (vraB)
    NCTC8325:
    Newman:
    NWMN_0539 (vraB)
    USA300_FPR3757:
    04-02981:
    SA2981_0553 (vraB)
    08BA02176:
    C248_0651
    11819-97:
    MS7_0565
    71193:
    ST398NM01_0650
    ECT-R 2:
    ECTR2_529
    ED133:
    SAOV_0610
    ED98:
    SAAV_0538 (atoB)
    HO 5096 0412:
    SAEMRSA15_05030
    JH1:
    SaurJH1_0613
    JH9:
    SaurJH9_0599
    JKD6008:
    SAA6008_00583 (vraB)
    JKD6159:
    SAA6159_00529 (vraB)
    LGA251:
    SARLGA251_05110
    M013:
    M013TW_0563
    MRSA252:
    SAR0581
    MSHR1132:
    SAMSHR1132_05190
    MSSA476:
    SAS0534
    Mu3:
    SAHV_0574 (vraB)
    Mu50:
    SAV0576 (vraB)
    MW2:
    MW0531 (vraB)
    RF122:
    SAB0526
    ST398:
    SAPIG0650
    T0131:
    SAT0131_00636
    TCH60:
    HMPREF0772_12613 (atoB2)
    TW20:
    SATW20_06450
    USA300_TCH1516:
    USA300HOU_0569 (vraB)
    VC40:
    SAVC_02465

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
    N315            MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
    NCTC8325        MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
    Newman          MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
    USA300_FPR3757  MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
                    ************************************************************

    COL             GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
    N315            GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
    NCTC8325        GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
    Newman          GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
    USA300_FPR3757  GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
                    ************************************************************

    COL             WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRGLQDEFAYRSHQL
    N315            WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
    NCTC8325        WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
    Newman          WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
    USA300_FPR3757  WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
                    *********************************************** ************

    COL             TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
    N315            TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
    NCTC8325        TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
    Newman          TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
    USA300_FPR3757  TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
                    ************************************************************

    COL             DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
    N315            DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
    NCTC8325        DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
    Newman          DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
    USA300_FPR3757  DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
                    ************************************************************

    COL             EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
    N315            EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
    NCTC8325        EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
    Newman          EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
    USA300_FPR3757  EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
                    ************************************************************

    COL             IASMGIGGGLGNAALFTRF
    N315            IASMGIGGGLGNAALFTRF
    NCTC8325        IASMGIGGGLGNAALFTRF
    Newman          IASMGIGGGLGNAALFTRF
    USA300_FPR3757  IASMGIGGGLGNAALFTRF
                    *******************