From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002354000
  • symbol?: vraC
  • description?: protein VraC

      descriptions from strain specific annotations:

    • protein VraC
    • VraC protein
  • strand?: +
  • coordinates?: 2894125..2894490
  • synteny block?: BlockID0016530
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0535 (vraC)
    NCTC8325:
    Newman:
    NWMN_0540 (vraC)
    USA300_FPR3757:
    04-02981:
    SA2981_0554 (vraC)
    08BA02176:
    C248_0652
    11819-97:
    MS7_0566 (vraC)
    71193:
    ST398NM01_0651
    ECT-R 2:
    ECTR2_530
    ED133:
    SAOV_0611
    ED98:
    SAAV_0539
    HO 5096 0412:
    SAEMRSA15_05040
    JH1:
    SaurJH1_0614
    JH9:
    SaurJH9_0600
    JKD6008:
    SAA6008_00584
    JKD6159:
    SAA6159_00530
    LGA251:
    SARLGA251_05120
    M013:
    M013TW_0564
    MRSA252:
    SAR0582
    MSHR1132:
    SAMSHR1132_05200
    MSSA476:
    SAS0535
    Mu3:
    SAHV_0575 (vraC)
    Mu50:
    SAV0577 (vraC)
    MW2:
    MW0532 (vraC)
    RF122:
    SAB0527
    ST398:
    SAPIG0651
    T0131:
    SAT0131_00637 (glnQ)
    TCH60:
    HMPREF0772_12612
    TW20:
    SATW20_06460
    USA300_TCH1516:
    USA300HOU_0570
    VC40:
    SAVC_02470

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQHYLLDSNQRLNVSFSKDSVAAYYQCFNQPYRKEVPPLMCASLWPKFDLFKKYANSELI
    N315            MQHYLLDSNQRLNVSFSKDSVAAYYQCFNQPYRKEVPPLMCASLWPKFDLFKKYANSELI
    NCTC8325        MQHYLLDSNQRLNVSFSKDSVAAYYQCFNQPYRKEVPPLMCASLWPKFDLFKKYANSELI
    Newman          MQHYLLDSNQRLNVSFSKDSVAAYYQCFNQPYRKEVPPLMCASLWPKFDLFKKYANSELI
    USA300_FPR3757  MQHYLLDSNQRLNVSFSKDSVAAYYQCFNQPYRKEVPPLMCASLWPKFDLFKKYANSELI
                    ************************************************************

    COL             LTKSAINQTQKIEVDTIYVGHLEDIECRQTRNITRYTMALTLTKNDQHVITVTQTFIKAM
    N315            LTKSAINQTQKIEVDTIYVGHLEDIECRQTRNITRYTMALTLTKNDQHVITVTQTFIKAM
    NCTC8325        LTKSAINQTQKIEVDTIYVGHLEDIECRQTRNITRYTMALTLTKNDQHVITVTQTFIKAM
    Newman          LTKSAINQTQKIEVDTIYVGHLEDIECRQTRNITRYTMALTLTKNDQHVITVTQTFIKAM
    USA300_FPR3757  LTKSAINQTQKIEVDTIYVGHLEDIECRQTRNITRYTMALTLTKNDQHVITVTQTFIKAM
                    ************************************************************

    COL             K
    N315            K
    NCTC8325        K
    Newman          K
    USA300_FPR3757  K
                    *